KEGG   Trichoplusia ni (cabbage looper): 113506840Help
Entry
113506840         CDS       T05757                                 

Definition
(RefSeq) trypsin-1-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113506840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tnl01002]
    113506840
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tnl04147]
    113506840
Enzymes [BR:tnl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     113506840
Peptidases and inhibitors [BR:tnl01002]
 Serine peptidases
  Family S1: chymotrypsin family
   113506840
Exosome [BR:tnl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113506840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 113506840
NCBI-ProteinID: XP_026745483
LinkDB All DBs
Position
2
AA seq 269 aa AA seqDB search
MFKLLFLGLNFLSTVTLFELDFSIFPTVDDLIYGPAPFDDRIVGGKEANIEDHPYQVSFI
VNNSYFCGGFIVSENYILTAAHCAQNVDPSTVVLRAGSSWRKNGTIIPIAEVIPHPQYDS
PRFDKDVAVMRTAEPIEFTETIQPIDLPKKGSSMKDNSIVMVSGWGRTEQGASSIPERLM
DVEIPVVPYWQCYAVYFTVLTRNMWCGGNFVLGGKGTCQGDSGGAAIQNNVVRGIVSFGR
GCGQRFSPGVFADMAAPTIRDFVTEHTGL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagcttttgtttctcggtttgaattttttgagtactgtaacactcttcgaactg
gacttttcaatctttcctactgtcgatgacctgatctacggtccagctcccttcgacgac
agaatagttggaggcaaggaggctaacatagaggaccatccgtaccaagtgtcctttata
gtgaacaactcttacttctgtggaggcttcattgtcagtgagaactacatcctgactgcg
gctcattgtgctcaaaatgtggacccatcaaccgtggtccttcgagccgggagttcgtgg
cgcaaaaatggaaccattataccaatagcagaagtgataccacacccgcagtacgacagc
ccgaggttcgacaaagacgtggccgtgatgaggacagctgagccaatagagtttactgaa
accattcagccgattgatcttcctaagaagggtagttccatgaaggataattctattgtc
atggtcagcgggtggggcaggactgagcaaggtgcaagctcgattcctgagcgattaatg
gacgtggaaataccagtagtaccctattggcagtgttatgcggtgtatttcacagtactt
acaaggaatatgtggtgcggaggcaacttcgttctcggcggcaaagggacttgtcagggt
gattccggtggtgccgcaatacagaacaatgttgttcgtggtatagtctccttcggtagg
ggctgtgggcagcgtttctccccgggcgtgtttgcagacatggccgcaccgactatccgg
gactttgttaccgaacatacgggtctgtaa

DBGET integrated database retrieval system