KEGG   Trichoplusia ni (cabbage looper): 113507858Help
Entry
113507858         CDS       T05757                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tnl  Trichoplusia ni (cabbage looper)
Pathway
tnl00020  Citrate cycle (TCA cycle)
tnl00190  Oxidative phosphorylation
tnl01100  Metabolic pathways
tnl01200  Carbon metabolism
Module
tnl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113507858
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    113507858
Enzymes [BR:tnl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     113507858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 113507858
NCBI-ProteinID: XP_026746580
LinkDB All DBs
Position
Unknown
AA seq 286 aa AA seqDB search
DAIHYMTREAPHAVIELDNYGMPFSRTPEGRIYQRAFGGQSLKFGKGGQAHRCCAVADRT
GHSLLHTLYGQSLRYDCEYFIEYFALDLLMEDGVCKGCIAINLEDGSLHRFQAKNTILAT
GGTGRSYFSCTSAHTCTGDGTAMAARAGLQNEDMEFVQFHPTGIYGAGCLMTEGCRGEGG
FLVNAKGERFMERYAPVAKDLASRDVVSRAMTVEIMEGRGCGPEKDHVHLQLHHXPPDQL
KQRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGTPTNFRGEVC
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gatgctatccactacatgacccgcgaggctcctcatgccgtcatcgagctggacaactac
ggcatgccgttctcccgtactcctgaaggtaggatctaccagagagccttcggaggacaa
tccctcaagttcggaaaaggtggccaggctcacagatgctgtgccgtcgctgacaggacg
ggtcactctctcctgcacacactgtacggacagtctttgagatacgactgtgaatacttc
atcgaatacttcgccctggaccttctcatggaggatggagtctgcaagggttgcatcgct
atcaaccttgaagatggatcactgcacaggttccaagctaagaacacgatcctggccaca
ggcggtaccggtcgctcttacttcagctgcacctcagcccatacctgcactggtgacggc
accgctatggctgcacgcgctggcttgcagaacgaagatatggagttcgtacagttccac
cctactggtatctacggagctggttgcttgatgaccgagggttgtcgtggtgagggaggt
ttcctcgtcaacgcgaagggagaacgtttcatggagcgttacgcgcctgtcgccaaggac
ctggctagccgtgacgtcgtctccagagctatgaccgtcgagatcatggaaggtcgcggc
tgcggccccgagaaggaccacgtgcacctgcagctgcaccacnctccccccgaccagctg
aagcagcgcctgcccggtatctccgagaccgccatgatcttcgccggcgtcgacgtcacc
aaggaacccatccccgtactgcccaccgtacattacaacatgggaggcacgcccaccaac
ttccgtggagaggtatgttag

DBGET integrated database retrieval system