KEGG   Trichoplusia ni (cabbage looper): 113508037Help
Entry
113508037         CDS       T05757                                 

Definition
(RefSeq) protein lava lamp-like
  KO
K20478  golgin subfamily B member 1
Organism
tnl  Trichoplusia ni (cabbage looper)
Brite
KEGG Orthology (KO) [BR:tnl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tnl04131]
    113508037
Membrane trafficking [BR:tnl04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    113508037
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 113508037
NCBI-ProteinID: XP_026746798
LinkDB All DBs
Position
2
AA seq 2900 aa AA seqDB search
MSDNKNNNPPETGQSDTADSNIASPSEVSSVTGSVKTSKTSQRMSSSSERQIKFERAQKC
LENAALVSKRIKEHRKATAELLGRPFEEDDGGDTASEMASTMSEKTGYSVATDTSAAMSV
QDALNIPGISESLANTLKQKELLMERIRQYKEISKKPMTKPTTIRRESTVEAKAEVKKAA
DNNDIMQLMNTIKDKENSLSVMQVKIKAMETTILDLQEMINEKDQIIEAKNKATTLMSDT
LSKKEKDSLVLLEDTRQQMTKMQENFIVMESEWKEEKSKLLKEIETSHQKINSLEEANTI
LETSRFEISVAHSKLVEELESKNQEILQLQERIESLSQMAVEEPPIKEKDDVEEEKGSLE
ISGMAELTKKIELLEQLNCQIRQTNKELENKLATVNIEPKSPSSSAPGKKGSPLPTRKGG
RNTAAKIKSPWSQLSSESLPQETDKKTAKTEIARLESVIQSLNKEILEKEYAIAQKDTLI
SELKLAPLIPEPKISVELVEVGVSTDVPEDVKEKLAQVDVEVKDQDSNLQSSPIDVSQSS
VVLELEEKLKAAEEQIIILNDDIDAANKNMIKVKSNNKLKLKQLQKTIENFSKVSDSNAE
IIKLNEELHQLSQKVAELEEEKGNLQLHLVDYDSGRLTDSDIYKKMVEMENLAETRLKAI
SVLEAQKFDLVQELHVLQQKNIEMEDKLADISQLQNEHVCTEMKSVQMEEQIDELIAAKK
ELELVIENIKLDKEHLNGTIKILQDEKDELAHKLENYIQENMELTDKLEKLSAEKVSSAE
SIEIVESLTTQEKLELEEYNKGISEDKPDDHHEEENVSSQNDKNIDILIQQREELNSKIE
LFTQERQEVMEKMAKIGSENESLLEKIANLNNQCSILENSIEMLNNEKQEIQDLNQELTR
QIEDMKRERIEIMKESAEIAKPSAEDITDGAQAEVHHDDKSAGDKGNKGAKTVKQLTKEI
LKLKNTIKEREDEIADCQMKILSMEEQQQKQNEILKTNVSNENKIKSLTEENYQLRQELE
VSKKDKESEQQLLQLKHSSELLQQELQKVHQEYAVNVASRDARINELENVLLEYEKQMYN
YGNSLQQKDKELSEYINQITKLNDVSQKLKSTIELLEEEKSKDQNAELVKSLNKQIAVYQ
KKMAENEEKIKALDEEKMQLHCVKGELVNKNTNLETELKKLKDAFNEKQNIIKELQVQQQ
KHSEEMSTIMLQTKERDEEIHEIKLQLRKESIENEKLRNNIMDKETQINDLTQQIEETKE
KLNHLSSEKDNSSERFVALETKNKELMEKLKKFAVTIKKKSAMYTELETHYEESQKQLSA
KNEQLEQLLIQVDTLPALQDKLKHAEEEMNRLQSQKVALEQQKIQDINQYQTELKSFQER
LVMSSQEISQLNDSVNILHKDLHFAREENMHLKSQIDALNNKLVEHEIEQRNNANLTTKI
SGLEADLSQKQMQIAELSNQVEHYERQQNQVQFGYDAKVQERDLYIENLEAEINKYKGRI
CRLEESISIMEDRRHSLERKADQLGTQLQEKQKAYSEYTSQEDELVGRLAVLMDHDRVLE
KQLFEIDNENKELQFKVQHLNEDNQKLRKALSEIQEHYNVMLEKANKLDLIEPEVSKYQA
QIRDLEANLKKVTHDHQSLVSQKKHEIEELEAEFNTQIENAIKEKKVLSEKYEKVNEYVS
QLENKLQEYKTNIENLNINIEELHKVNHDLMEKSSKKEQPATPDYTEQYIGEINKLNAIV
NNKSQNIAELSNTIQVQQMKTASLENSLFELSENLKASSFEIEQLQLAMNLLKQDNTELQ
SKLSEKEEQIRELKENQKLTFEMNIPKTEGMIISSTIEQLSGDNKGFDISSLESQIVSGM
EEPSVESKHVVKKVSEHIQKQPGEENVVEPEIVAKKAYVCYTKDDEENVGPEVDPFNSDE
GWGLGESEDVVDVSPDVTHLNVQIQQLKRDNEVLRTELETNNTKLIKALKKLKELKTNNE
VLSKELKVAKQVSQSSFFDNAMEDELRLNVQDLEKKLDELNTEINKEKRDKESLRKQNEV
FHNANDRLMEMKDKLESEIELWKFKFKEANDKLSTLQWGGETKDSQTVEQKSPVAGLDED
KFKDELLKIEKENDELQSMVDQLNTQNNELLSQQTLLKNEIGNLQTQLQQNKTASHNSEQ
LQSQLNQLQQNNDLLVKTNESLSEKLQNIEIQCNNLSENAEKYNIIKTQFDDLEKEKAEW
IGIQSKLQDEVLSLKQLRSDDEDKISSLSTQLEDSKSKIIFLEEQQNLNKFQSADSLALA
EKYSSIEQYCAELKHNLDDANAKISLLESENENSIQKSKEYQNQITELNAKIEQLNVEND
TLLSTVAELRSSVSSAIDQRGFEIAELWKQHLAQREADFQKIETDLRTQLNTAEAKYEQL
LENVQSSNQEETSKLVVIEQVTSLQNKLEDKEEHVRNLQTKYAEVMNQLDMLRSEVEDEK
VAQENKLLEQQEEYEKVIQELTVNSHKNTQTYEETFKNIQNELMIFKSNNDGLNQVIEDL
NGKIKEAEEKVIEVTNQLRLKESEIYQKTHDYTITLTQRNEEFENVRRQLIEYEKKIEEL
SYEKESELAVLRLKIHERDSHHEKAISEANAEKESILAALNDKIFECTNLNKQIVDLNKE
LENNSMKAAEMQAALENQEIEIVGLNDEITNLQNLLRSSSAKIQKHVSFASDTKPGTEGE
QSENLMSKDLLDAVPRAELDLALYMLHQRDVRCEELTMELTQLLEERDTLQLRLSDSLRS
NEEMKNKARIAGLEESMNSSQETISELPSFSIEKEFVDTHRGQTSRSSSISEMEGEKPKL
QAKLTELRSVKHSRDVRFRQESEQRQLDLRLLSRDVANLPPEAVDQLAQAHHTLSRDSQS
TSTVLLNWLRGKSTPKVVHM
NT seq 8703 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaataaaaacaataatccccctgaaacgggacaatcggatactgctgacagc
aatatagcatcacctagcgaagtgtctagtgtcacaggaagtgtaaaaacttctaagaca
tctcagcgcatgtcatcatcttctgaaaggcaaataaagtttgagcgtgctcagaaatgc
cttgagaatgctgcccttgtgtcaaaaaggattaaagaacaccgaaaagctactgcagaa
ttacttggaagaccatttgaagaggatgatggcggtgacactgcttctgaaatggcttcc
accatgagtgagaagactggatactctgtggccactgacacctccgcagctatgtctgtg
caggatgctttaaacatacctggcattagtgagagcttagcaaacaccttgaaacagaag
gagcttctcatggagaggataagacagtacaaagagatcagtaagaaacccatgactaaa
cccacaaccatcaggagggaatcaacggttgaagctaaagcagaagtcaaaaaggcggct
gacaacaatgacataatgcaacttatgaacacgataaaggataaagagaatagtcttagt
gtgatgcaagtaaaaataaaagcaatggaaactactatcctagacctacaggagatgata
aatgagaaggaccaaattattgaagctaaaaataaggcaacaactctcatgtcggatact
ttaagtaaaaaagaaaaagactccctagttttacttgaagacacaaggcaacaaatgaca
aaaatgcaagaaaattttatagttatggaatctgaatggaaagaagaaaaatcaaaattg
ttaaaggaaattgaaacaagtcaccaaaaaattaatagtttagaagaagcaaatactatt
ttagaaacctctcgttttgaaattagtgtcgctcattccaaattagttgaagaattagaa
tctaaaaatcaggaaatacttcagttgcaagagaggatagaaagcttgtcgcaaatggct
gtagaagaaccacctattaaagaaaaggacgatgtagaagaggagaagggctctttagag
atttctggtatggctgagttgacgaaaaagattgagttattggaacaattgaactgtcaa
attaggcaaacaaacaaggaactagaaaacaaactggcaactgtaaatattgaacctaaa
tcaccaagtagtagtgctccaggcaagaaaggtagccctcttcctacccgcaagggcgga
agaaacacggcagccaaaataaaatctccctggagccaattatcctcagagtcattacct
caagaaacagacaaaaagacagcaaaaactgaaatcgcacgcctagaatcggtaatacaa
tcccttaacaaagaaatacttgaaaaggaatatgcaatagctcaaaaagatacgttaata
tctgaactaaaactcgcgcccttgataccagaacctaagatatctgttgaactagtagaa
gttggtgttagtactgatgtgccagaagatgttaaagagaaacttgctcaagtggatgta
gaagtaaaagaccaagattctaacctacaatctagtcctattgatgtaagtcaatcaagt
gtggtactggagctagaagagaaattgaaggctgctgaagagcaaatcatcattctaaac
gatgatattgacgcagctaacaaaaacatgattaaagtgaagtcgaacaataaattgaaa
ctgaaacagctgcagaaaacaattgaaaacttcagtaaagtgtcagattcaaatgcagag
ataataaagttgaatgaagagttgcatcaactttcccagaaagtggctgaattggaggaa
gagaaaggcaatctccaattacatcttgttgattatgatagtggcagattgactgattcg
gacatttacaagaaaatggttgagatggagaatttagcagaaacgcgactcaaagccata
agtgttttagaagcgcagaagtttgatctggttcaagaacttcatgtgttgcagcagaaa
aatattgagatggaagataaattagcagatatatctcaactccaaaatgaacatgtttgc
actgaaatgaagtccgtccagatggaggaacagattgatgagcttatagctgctaagaaa
gaattagaacttgttatagaaaacattaaattagacaaagaacatcttaacgggactatt
aaaatccttcaagatgagaaagatgagttagctcataaattagagaattacatccaagaa
aacatggagctaacagacaaactcgaaaaactaagtgccgaaaaagttagttccgcagaa
tcaattgaaattgtagagtcactgactacacaagagaaacttgagcttgaagagtacaac
aaaggcataagtgaggacaaacctgatgaccatcatgaagaggaaaatgtttcttcccaa
aacgataagaacatagacatcttaattcaacaaagagaagaattaaatagcaaaattgaa
ttattcacacaagaaagacaagaagttatggagaaaatggccaaaataggatcagaaaat
gaatccttactcgaaaagatagccaatctgaataaccaatgcagtattttagaaaatagt
atagaaatgctaaataacgaaaaacaggaaatacaagatttgaaccaagagcttacacga
caaattgaagatatgaagcgtgagagaattgaaataatgaaagagtctgctgaaatagcg
aaaccatccgctgaagacattactgacggagcgcaggctgaagtacatcatgatgataag
tctgccggagataagggcaacaaaggagcaaaaacagtgaaacaactcacaaaagaaata
cttaaattgaaaaacactatcaaagaaagagaagacgagattgctgattgtcaaatgaaa
atactgtccatggaagaacaacagcaaaaacaaaacgagatactaaagacaaatgtgtct
aatgaaaataaaataaaatctttaacagaggaaaattaccaattgagacaagaattggaa
gttagtaagaaggacaaggaatctgaacagcagttactccaactaaaacattctagtgaa
ttattacaacaggaattacaaaaagtccatcaagaatacgctgttaatgttgcgtcacgt
gacgcgaggataaatgaacttgagaacgttttgttggagtacgaaaaacaaatgtataac
tatggaaatagcctacagcagaaagacaaggagctgtcagagtacatcaaccaaataaca
aaactcaatgatgtttcacagaaacttaaatccactattgaattactcgaagaagaaaag
tccaaagaccaaaatgcagagcttgttaaatcgcttaacaaacagatcgctgtctatcag
aaaaagatggccgaaaacgaagaaaaaatcaaagcactagatgaagagaaaatgcaactc
cattgcgtgaaaggagaacttgttaataaaaatacaaacctcgaaacagaattgaagaag
ttaaaagacgcctttaatgagaagcaaaatattattaaagaattgcaagtacaacaacag
aagcattccgaagaaatgtctaccataatgttacaaactaaagaaagggatgaagaaatt
catgaaatcaaattgcaactaagaaaagaatctatagaaaatgaaaaattgcgtaataac
atcatggacaaggaaacacaaattaatgatttaacacagcaaattgaagaaaccaaagaa
aagctgaatcacttatcgtcagagaaagacaattcatctgaacgatttgtggcattagag
acgaaaaataaagaactgatggagaaattaaagaagtttgcagttacgattaaaaagaag
tccgcaatgtacactgaactagagacacattacgaagaatctcagaaacaacttagtgct
aagaatgaacagttagagcaactccttattcaagttgacacactccctgccttacaagat
aaactgaaacatgccgaggaagagatgaatcggttacaatcgcaaaaagtggctttagaa
cagcaaaaaatacaagatattaaccaatatcaaacagaactcaaatcattccaagaaaga
cttgttatgtcatctcaggaaatatctcaattgaatgattcagtcaatatcttacacaaa
gacttgcactttgctcgagaggaaaatatgcatttaaaatcacagattgacgctttaaac
aacaagttagtggagcacgaaatagagcagagaaataatgccaacttgaccacaaaaata
tctggtttagaagcagacttaagccaaaaacaaatgcagatagccgagttatcaaatcaa
gttgaacattatgagcgtcaacagaatcaagtacagtttggatacgacgctaaagtgcaa
gaacgagacttatacatcgagaacttggaagctgaaataaacaagtataagggtcgtatt
tgtcgccttgaagaaagtatttctattatggaagatagaagacattctttagagcgtaag
gctgatcaattaggcactcagctgcaagaaaagcaaaaggcttactcagaatatactagt
caagaagacgagttagtcggtcgtctagctgtacttatggatcatgacagagttcttgag
aagcaactattcgagattgataacgaaaataaggagttgcaatttaaggttcaacatctt
aatgaagataaccagaaattaaggaaagccctatctgaaattcaggaacattacaatgta
atgcttgaaaaagcaaataaactcgacttaattgagcccgaagtttctaagtaccaggca
cagattcgtgatcttgaagcaaacttaaagaaagtaacccacgaccatcagtctttagtt
tcgcaaaagaagcacgagattgaagaactcgaagcagaatttaacacacaaatagagaac
gcaattaaagagaaaaaagtattgagtgagaagtatgaaaaagttaacgaatacgtgtct
caactagagaataaactgcaggaatacaaaacaaacatagaaaacctgaacatcaatata
gaagaactacataaagttaaccatgacttaatggagaagtcgtctaaaaaggaacagcct
gcaacaccagattatacagaacagtacataggcgaaattaacaaattaaatgctattgtt
aataacaagagtcaaaacatagcagaacttagtaacacaatacaagttcaacaaatgaag
acagcaagtcttgaaaatagcttattcgaattatccgaaaacttaaaagcatcttctttc
gaaatagagcaattgcagctagcaatgaatttattaaaacaagataatactgaattacaa
tccaaactctctgaaaaagaagaacaaattagagaattgaaagagaatcagaaactgacg
tttgaaatgaatattccaaaaactgaaggtatgatcatttcatctactattgaacagctt
agtggtgataacaaaggatttgatatctcatctcttgaatcgcaaatagtatctggtatg
gaagaaccttctgttgaaagcaaacatgtcgttaagaaagtctcagaacatatccaaaaa
caaccgggagaagagaatgttgtggaaccagaaattgtggcgaaaaaggcctatgtgtgt
tatactaaagacgatgaagaaaatgtgggtccggaagtggatcccttcaattctgatgaa
ggttggggcttaggtgaaagtgaagacgtagttgacgtatcacccgacgtaacacacttg
aatgtccaaattcaacagctgaagagagataacgaagtattaagaacggaacttgaaacg
aataacacaaaacttataaaagcattaaagaaattaaaggagcttaaaaccaataatgaa
gtgctctccaaagagcttaaagtggctaagcaagtttcacagtcttcctttttcgataac
gcaatggaggacgaacttcgtcttaatgttcaagatttagaaaagaagctcgatgaacta
aatacagaaattaataaagaaaaacgtgacaaagaatcgctaagaaaacaaaatgaagtc
ttccataatgccaatgatagattaatggaaatgaaggataaactagaaagcgaaatagaa
ctgtggaaatttaaattcaaggaagctaatgataaactctcgactttgcaatggggtggg
gagaccaaagactcccaaacagtcgagcaaaaatcccccgttgcaggtctagatgaagac
aaatttaaggatgaactactaaaaatagaaaaagaaaatgatgaattacagtctatggta
gatcagctaaacactcaaaataatgagcttctctctcagcaaactttattgaagaatgaa
atcggtaatcttcaaacacagctgcagcaaaacaagactgcaagccataatagtgaacag
ttacaaagtcaacttaatcagttacagcaaaataatgatttgctggtgaaaactaatgag
tctttgtcagaaaaattgcaaaatattgaaattcagtgtaacaatttatcagaaaatgcc
gagaagtataacataataaaaacacaatttgatgatttagaaaaagaaaaagcagaatgg
attggcattcaatctaaattacaagatgaagtactatcccttaaacaattacgttccgac
gatgaagacaaaatctcttctttgtcaactcaactggaagattctaaatcaaagataatt
ttcctcgaagagcagcagaacttaaataaattccaaagcgcggatagtttggctctggct
gaaaagtacagttcaatcgagcagtattgtgcagaattaaaacataatttagatgatgca
aatgccaaaatatcactattagaatccgaaaatgaaaattcgattcaaaagtccaaagag
tatcagaatcaaattactgaacttaatgcaaaaatcgagcaattgaacgttgaaaacgat
actttactgtctactgtcgccgagttgcgttcatctgtgtccagtgcaatagatcagaga
ggtttcgagattgcggaactatggaagcaacatctagcgcaaagggaagcagacttccaa
aagattgaaactgatttaagaacgcaattaaatacggccgaagctaaatatgaacagtta
ttagaaaacgtacagtcttctaaccaagaagaaacaagtaagttggttgttattgaacaa
gttacctcattacaaaataagttagaggataaagaagagcatgtaaggaatttacaaaca
aaatatgccgaggtcatgaaccagttagacatgttacgttcggaggtagaagacgaaaaa
gttgctcaagaaaataaattattagaacaacaagaagaatatgagaaagttattcaagaa
cttactgtaaatagtcataaaaatactcagacttatgaggaaacctttaagaatatacaa
aacgagcttatgatatttaaatccaataatgatggactaaaccaagtaattgaagactta
aatggtaagataaaagaagccgaagagaaagttatcgaggtgactaatcaacttcgactg
aaagagagcgaaatatatcagaaaacccatgactatactattacactgacgcaaagaaac
gaggagtttgaaaacgtaagacggcagttgatcgagtatgaaaagaaaatagaggaatta
agttacgaaaaagaatccgagttagcagttctaagattaaaaatacacgaaagagacagc
catcatgagaaagcgataagtgaagcaaatgctgaaaaagagagtatacttgcagcgtta
aacgataaaatttttgagtgtacaaatctaaacaaacagatagttgacttgaacaaggag
ttagaaaataattccatgaaggctgcagaaatgcaagccgccttagaaaaccaggaaata
gaaatagtcgggcttaatgacgaaataacgaatttacaaaacttattgcggtcgtctagt
gctaaaattcaaaaacacgtttcatttgcgtctgataccaaacctggtactgaaggtgaa
caaagcgaaaaccttatgagcaaagacctgttggacgcggtgccacgggctgagctagac
ttggccctctacatgttacaccagagagatgtgaggtgcgaggaactcaccatggagcta
actcagctgctggaggaaagagataccttacaattgcggctatcagacagtctccggtcc
aacgaagaaatgaaaaacaaagcgagaattgcaggattggaggagtcgatgaactctagt
caagaaacaatatctgaactgccgagctttagtatagaaaaggagtttgttgatacgcat
cgcggacagacgtcaagaagcagcagtataagtgaaatggagggcgagaaaccaaagttg
caggctaagttgacggagctgcgtagtgtgaagcatagccgcgatgtacggttccggcag
gagagcgagcaacggcagctggacctgcggctgctgagccgggacgtggccaacctgccg
cctgaggcagtcgaccagctagcgcaagcgcaccacacgctctctcgggattctcaaagt
acgtcaacggttcttctaaattggctgcgagggaaaagtacaccaaaagtagttcacatg
tga

DBGET integrated database retrieval system