KEGG   Thermotoga naphthophila: Tnap_0936Help
Entry
Tnap_0936         CDS       T01139                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00040  Pentose and glucuronate interconversions
tnp00051  Fructose and mannose metabolism
tnp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tnap_0936
   00051 Fructose and mannose metabolism
    Tnap_0936
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Tnap_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Shikimate_DH ThiF 2-Hacid_dh_C Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADA67026
UniProt: D2C7U0
LinkDB All DBs
Position
977053..978075
Genome map
AA seq 340 aa AA seqDB search
MKAVYLVKPKQLELREIDIPAPLPGEVLIKIKAVGICGSDVHFYEHGRIGNFVVEKPIIL
GHEAAGEVVEVGEGVENLMPGDRVAIEPQVPCRKCKYCKTGRYNICPDVEFWATPPTDGA
FREFVTHPADFCFKLPDNVSYEEGAMMEPLSVGLWAVERSGVKPEHKVAILGSGTIGIMV
LQCLKAVGVTDITVFDIFPSKLEIARNLGAKEVVLVKAKEDYKNFYNSFDVVFETAGSDV
TVSEIPHILSIGGRGILVGLPPSDSVPLNVTELIAKEATIETVFRYANMYPRAVELVSEG
KIMLKSLISRYFDLEHVPEAFEYVISKRAEIVKVMIVNNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtatatctggtaaaacccaaacaattagagttacgggaaatcgatattcca
gctccattgcctggagaagtactcattaagatcaaagctgtaggaatttgtggttctgac
gtccatttttacgagcatggaagaatagggaattttgtagtagaaaaaccgataattctt
ggtcatgaagcagctggtgaggtggttgaagtaggagagggtgtagagaatttgatgcca
ggggatagggtagctattgaacctcaagtaccttgtagaaaatgcaaatattgtaaaact
ggaagatacaacatatgtccggatgtagaattttgggctactccgccaactgatggtgct
ttcagggaatttgttacccacccagctgatttttgctttaagcttccagacaacgtttct
tatgaagaaggagctatgatggaaccattatcggttggattatgggcagttgaacgttca
ggagtgaaacctgagcataaagtggctatcctaggttcaggaacaataggaataatggtg
ttacaatgtctaaaagctgttggcgtgacggacattactgtttttgacatctttccttct
aaattggaaatagcaagaaatttgggggcaaaagaagtggttttggtaaaagccaaagaa
gattataaaaatttctacaacagttttgatgttgtctttgaaacagcaggaagtgatgta
acagtatcggaaattcctcacatcctttctattgggggacgagggattttagtaggtcta
ccaccttcagattctgttcctttaaatgtcacagaactaattgctaaagaagccacaatt
gaaacggtttttcgatatgccaacatgtatccaagagctgtagagttagtttccgaagga
aaaatcatgctaaagtccctgatttccagatattttgatttggaacatgtacccgaagct
tttgaatacgtaataagcaaaagagctgaaattgtaaaagtaatgattgtcaataacaaa
tag

DBGET integrated database retrieval system