KEGG   Thermotoga naphthophila: Tnap_1380Help
Entry
Tnap_1380         CDS       T01139                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tnp  Thermotoga naphthophila
Pathway
tnp00564  Glycerophospholipid metabolism
tnp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tnp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tnap_1380
Enzymes [BR:tnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tnap_1380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 NAD_binding_8 Trp_halogenase Pyr_redox TrkA_N FAD_oxidored HI0933_like FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADA67463
UniProt: D2C409
LinkDB All DBs
Position
complement(1374984..1376423)
Genome map
AA seq 479 aa AA seqDB search
MKAIVIGGGVFGSLVARELTKYDLEVTLIEKNLDVGWGVTKANSAIVHAGYDDTPGSVRA
QFCALGNAMYEGLSKELDFDFERIGSFVVAFNDEELKELERLLKQGEENGVPGLTILERD
EILSMEPNLNPEVKYALYAPTAGITEPWMVAIAAVENAVQNGLKLVLGERVVGFEKVNGR
VRKIHTSKGEYEADIVINCAGLHADEIAKLAGAEYVPLHPRKGEYILLDKKLQGLVKRVI
FPTPTKVSKGILVLPTIDGGILLGPTAEDLSEEMKDRPVTTREGLEKVREFTKKLVPSLD
FSLVVKTFSGLRPESPQKDFFIKVSETVKNFVNVMATRSPGLTAAPAVARYVVEELIQEK
MRLPLEKKKDFKPERKRIVHYSEFPLEEWRREIEKDPRAGRLVCFCNEVTEKEIVEAIRR
GARTLDGVKFRTRAMFGRCQGGFCMARILKILERELSVDMSEIRMKSENSWVVNGKVRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatcgtcataggtggaggagtgtttggttctctggtagcgcgagagttaacg
aagtacgatctggaagtgactctcatagagaagaacttggatgtaggctggggagtaaca
aaggcgaattcagccatcgttcacgctggttacgacgatacacctggaagcgttcgtgcg
cagttttgtgcgttgggcaacgcgatgtacgaaggtctctcaaaagagctggatttcgat
ttcgagagaataggatctttcgtggtggcattcaacgatgaagaactgaaggaactcgag
cgtcttctaaaacagggcgaagaaaacggtgttccaggtttgaccatcctggagagagac
gaaatactttccatggagccgaatttgaatccagaggtcaaatatgctctatatgccccc
actgctggcatcacagaaccctggatggttgccatagcggctgtggaaaacgctgtccag
aatggattgaaactcgttcttggagaaagagtcgttggctttgaaaaagtcaacggtcga
gtgaggaagattcacaccagcaaaggcgaatacgaagcggatatcgtgataaactgtgct
ggactccacgcagacgagatagcgaagttagccggtgcagaatacgttcctctgcatcca
aggaaaggcgaatacatcctcctcgataagaagcttcagggcctggtaaaaagggtcata
tttcccacacccactaaggtctcgaagggaatactcgttcttcccacaatcgatggcgga
attcttctgggaccaactgctgaagacctttctgaagagatgaaggacagacccgtaacc
accagagagggcctcgaaaaagttcgagaattcacaaaaaaactcgtaccttccctcgat
ttctccctcgtggtgaaaaccttctcagggcttagaccggaaagtccacaaaaagacttc
tttataaaggtgagcgagacggtgaagaacttcgtaaacgttatggcaacaagatctccg
ggactcacagcagcgccggcggtggcaaggtacgttgtcgaagagttgatccaggagaaa
atgagacttcctcttgagaagaaaaaagacttcaagcccgaaagaaagagaatcgttcac
tattcggagtttccccttgaagagtggaggagggaaatagaaaaagatccacgtgcagga
agactcgtttgcttctgcaacgaagtgacagagaaagaaatagtagaagccataagaaga
ggagcaaggacactcgacggtgtgaagttcagaacaagagcgatgtttgggaggtgtcag
gggggcttctgcatggctcgtattctcaagattctggagagagaactcagcgtggatatg
tcggaaataagaatgaaatcggagaacagctgggttgtgaacgggaaggtgagagaatga

DBGET integrated database retrieval system