KEGG   Thermodesulfobium narugense: Thena_0494Help
Entry
Thena_0494        CDS       T01488                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00010  Glycolysis / Gluconeogenesis
tnr00020  Citrate cycle (TCA cycle)
tnr00620  Pyruvate metabolism
tnr00633  Nitrotoluene degradation
tnr00640  Propanoate metabolism
tnr00650  Butanoate metabolism
tnr00680  Methane metabolism
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
Module
tnr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thena_0494
   00020 Citrate cycle (TCA cycle)
    Thena_0494
   00620 Pyruvate metabolism
    Thena_0494
   00640 Propanoate metabolism
    Thena_0494
   00650 Butanoate metabolism
    Thena_0494
  09102 Energy metabolism
   00680 Methane metabolism
    Thena_0494
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thena_0494
Enzymes [BR:tnr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thena_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEE14134
UniProt: M1E7T3
LinkDB All DBs
Position
494641..495828
Genome map
AA seq 395 aa AA seqDB search
MARKSVGLTGDYAVAEAMRQIDPDVVAVYPITPQTLIVEKFGEFVADGIVHTEFVPVESE
HSALSACCGASAAGARTMTCTSSQGLALMHEILYIAAGNRHPIVMVDVNRALSAPINIHG
DHSDTMGSRDAGWIHLYCFNGQEAYDSTIIATRIAENPNVYLPVIVGLDAFNISHNTERI
ELLDDQEVKDFVGEFNPPYSLLDLKYPVSVGAYFLPDYYMEARRKLQEVIQNSKKVIVEI
HEEYNKKFGRNVPAIMETYKMEDAEYAILAMSSITGVAMLAADELRSKGIKAGVIRLRLF
RPFPADELYEAISNLKGLAVVERADAYGAACAPIFSELSGACANKKKMPLMANYVIGLGG
RDVKIKDMKSIFEDIVAKVNKGEVKDLRQYIGVKG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaaaaagtgttggtttaactggagattatgcagtagcagaagcaatgagacaa
attgatccagatgtagttgcagtctatcctattacgcctcagactttgatagttgaaaag
tttggagaatttgtggctgacggtattgttcatactgaatttgttcctgtagaatcagaa
cattcagcactttcagcatgttgtggagcgtcggctgctggagctagaacaatgacttgt
acatcttcacagggtcttgctcttatgcatgaaattttatatatagcagcaggaaataga
catccaatcgtaatggtagatgtcaatagagcactttctgctcctattaacattcacggc
gatcacagcgatactatgggttcaagagatgctggctggattcatctttattgtttcaac
ggccaagaggcatacgattcaactattatagcaacaagaattgctgaaaatccaaatgtt
tacctgccagttattgtaggtcttgatgcttttaacatttctcataacactgaaaggata
gaacttttagatgatcaagaggtaaaagactttgttggagagtttaatccaccttattcg
cttttggatttgaaatatccagtaagtgtgggtgcttactttttgccagattactatatg
gaggcaagaagaaaacttcaggaggttatccaaaattcaaaaaaggtaattgtagaaatt
catgaagagtataacaagaagtttggaagaaatgttcctgctattatggaaacttataag
atggaagatgccgagtatgctatattggctatgtcatcaataacgggcgttgcaatgctt
gcagctgatgaactgagatctaaggggattaaagcaggtgttataagacttagactcttt
agaccatttcccgctgatgaattatatgaggctatttctaatttgaaaggtttagctgtt
gtagaaagggcagatgcctatggagcagcatgtgcacctattttttcagaattgtctggt
gcttgtgcaaataaaaagaagatgcctctaatggccaactatgtaattggtttgggcgga
agagacgtaaaaatcaaagatatgaaaagtatttttgaggatatagtggctaaagttaat
aaaggagaggtaaaagatttgagacagtatataggcgtgaaaggataa

DBGET integrated database retrieval system