KEGG   Thermodesulfobium narugense: Thena_0668Help
Entry
Thena_0668        CDS       T01488                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00473  D-Alanine metabolism
tnr00550  Peptidoglycan biosynthesis
tnr01100  Metabolic pathways
tnr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tnr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thena_0668
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thena_0668
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Thena_0668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tnr01011]
    Thena_0668
Enzymes [BR:tnr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Thena_0668
Peptidoglycan biosynthesis and degradation proteins [BR:tnr01011]
 Precursor biosynthesis
  Amino acid ligase
   Thena_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp RimK ATP-grasp_3 ATP-grasp_4 GARS_A ATPgrasp_ST ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AEE14303
UniProt: M1E6S7
LinkDB All DBs
Position
645306..646232
Genome map
AA seq 308 aa AA seqDB search
MKILILCGGTSSEKEVSIWSAENVYKSLINTEYIVEMVDIATLSPYELCQKILCENFDLV
FPVLHGKPGEDGSIQGFLDTLGIKYIGSGVFSCAITMDKYRYKLICKSLEFPQPDFIAIR
TKDSTEVLEFVRLKGFPLVVKPNSQGSSVGVSIVNNNNELKDALELGFKYDPIVLVEEFI
HGKEITCGVIGNSNVIALPLVEILPKTKFFDYESKYNPQLCDEIVPARLNDNLKDRLQEL
AIKAYKAFDCKCFGRVDMFVDKYENIYLSEINTIPGLTANSLFTKEVKAAGYSFQEIVKL
LVKLALED
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttgattttatgtggtggaacttcttcagaaaaggaagtttctatatggtct
gcagagaacgtttataagtccttgattaatactgaatatatcgttgaaatggtggatatt
gctacactttctccttatgaattgtgtcaaaaaatattatgtgaaaattttgatcttgtt
tttccagttttacacgggaagcctggagaagatggctctatacaaggttttttggatact
cttggaataaaatatatcggttctggagttttttcgtgtgcaataactatggacaaatac
aggtacaaattaatttgtaaatctttggaatttccacaaccagattttattgctataaga
acaaaggattctacagaggttttggaatttgtgcgtttgaaaggctttcctttagttgta
aaacctaattcgcaaggttcaagtgtaggagtatctattgtgaacaataataacgaattg
aaagatgccttggagcttggatttaaatacgatccaattgttctggttgaagaatttata
catggaaaagagataacatgtggtgttatcggaaacagcaatgtaattgccctgcctctt
gttgaaatattgcccaaaacaaaattttttgattatgagtcgaaatataatcctcaattg
tgtgacgaaattgttcctgcaagattaaatgacaacctaaaggatagattacaagagcta
gcaataaaagcatataaggcttttgattgcaagtgttttggcagggttgatatgtttgta
gataaatatgaaaacatttacctctctgaaataaacactattcctggtttgactgcaaat
agtctttttactaaggaggttaaagctgctggatattcgttccaggaaattgttaaactt
cttgtcaaactggcgttggaggattaa

DBGET integrated database retrieval system