KEGG   Thermodesulfobium narugense: Thena_0770Help
Entry
Thena_0770        CDS       T01488                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
tnr  Thermodesulfobium narugense
Pathway
tnr00030  Pentose phosphate pathway
tnr01100  Metabolic pathways
tnr01110  Biosynthesis of secondary metabolites
tnr01120  Microbial metabolism in diverse environments
tnr01130  Biosynthesis of antibiotics
tnr01200  Carbon metabolism
tnr01230  Biosynthesis of amino acids
Module
tnr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thena_0770
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Thena_0770
Enzymes [BR:tnr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Thena_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AEE14404
UniProt: M1E8D0
LinkDB All DBs
Position
752466..753386
Genome map
AA seq 306 aa AA seqDB search
MKATREAYGEALLELGRSNDKVVALDADLSKSTKTSLFAKEFPERFFNVGIAEQNLIGVA
AGLSLAGFVPYASTFAIFATGRAWEQIRNTVAYPSLNVKICASHAGITVGEDGASHQSIE
DIALMSVIPNMTVLVPADPIETKSMVNWAYQHNGPVYIRLGRMGVPNILPNDYKFDTKPF
ILKKGKKIVIFATGIMLWKCLEAIELLKPYNLEPTLVNVSCIKPLPEESIIEIAKEHEIV
LTAEEHNIINGLGSMISSTLSRNYPMKVSFIGINDKFGTSGKPNDLLSYYGLDANSIKEK
LLLLGS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaccagggaagcttatggagaagcactattggagttgggaaggtcaaacgat
aaagtagtagctttggatgcagatctttctaaatctactaaaacttcgctctttgcaaag
gaatttcctgagagatttttcaatgttgggatagctgaacaaaatttgataggagtagct
gccgggctttctcttgcgggattcgttccttatgctagtacctttgcaatatttgctact
gggagagcgtgggagcagattagaaatactgtggcttatccatctttaaacgttaaaata
tgtgcatctcatgcaggaattactgtaggagaggatggggcatcacatcaatctatagaa
gacatagctttgatgtcagtaattcctaatatgacagtgttagttcctgcagatcctata
gaaacaaaatcaatggtaaattgggcatatcagcataatggtcctgtgtatataagattg
ggaagaatgggagttccaaatattttacctaatgattataaatttgatacaaaacctttt
attctaaaaaaaggaaaaaaaatagtgatatttgctactggaataatgttgtggaaatgt
cttgaagcaattgagctattgaaaccttataacttagagccaactttagtaaatgtttct
tgtataaagccccttcctgaagagtctataatagaaattgcaaaagagcacgaaatagta
ttaactgctgaagaacataatattataaacgggcttggatcaatgatttcatcaactctt
tcgagaaattatccaatgaaagtatcttttattggtatcaatgataaatttggaacatca
ggaaaaccaaatgatttattaagttattatggcttggatgcaaacagtataaaagagaaa
ttgttattattagggtcgtaa

DBGET integrated database retrieval system