KEGG   Thermococcus nautili: BD01_1640Help
Entry
BD01_1640         CDS       T03065                                 

Definition
(GenBank) Ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tnu  Thermococcus nautili
Pathway
tnu00630  Glyoxylate and dicarboxylate metabolism
tnu01100  Metabolic pathways
tnu01120  Microbial metabolism in diverse environments
tnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BD01_1640
Enzymes [BR:tnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BD01_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AHL23244
UniProt: W8PMI5
LinkDB All DBs
Position
1440713..1442047
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKDYEPNKKRDIIAVFRVTPAEGYTIEAAAGAVAAESSTGTWTTLYP
WYEQERWADLSAKAYDFIDMGDGSWIVRIAYPFHAFEEWNLPGLLASIAGNVFGMKRVKG
LRLEDLYIPEIVLRNFNGPAFGIEGVRKMLEIYDRPLYGVVPKPKVGYSPEEFEKLAYEL
LSNGADYMKDDENLTSPWYNRFDERAEIMARIIDKVENETGEKKTWFANITADIREMERR
LEILADLGLKHAMVDVVITGWGALEYIRDLAADYGLAIHGHRAMHAAFTRDKYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILREETYTPDENDVFHLEQKFYGMK
AAFPTSSGGLHPGNIEPVIEALGKDIVLQLGGGTLGHPDGPGAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaagttcgacaagatatacgactactacgtggacaaggactacgagccgaac
aagaagagggacatcatagccgtgttccgcgttacccccgccgaggggtacaccattgag
gcggccgcaggtgcagtcgccgccgagagctcgaccggaacctggacgaccctttacccc
tggtacgagcaggagcgctgggccgacctttcagctaaagcctacgacttcatagacatg
ggagacggaagctggattgttaggattgcctacccgttccacgccttcgaggagtggaat
ttacctggccttctcgcgagcatagcgggcaacgtcttcggaatgaagcgcgttaagggc
cttcgccttgaggacctctacattccggagatagtcctcaggaacttcaacggaccggcc
tttggtatcgagggcgtcaggaagatgctcgagatatacgacagaccgctctacggcgtc
gtccccaagcccaaggtaggctactcgccggaagagtttgaaaagctcgcctacgagctc
ctctccaacggtgcagactacatgaaggacgacgagaacctcacaagcccctggtacaac
cgcttcgacgagagggccgagataatggcgaggattattgacaaagtcgagaacgagacc
ggcgagaagaagacctggttcgccaacattaccgccgacatccgcgagatggagaggcgc
cttgagattctggccgacctcgggctcaagcacgcgatggtcgacgtcgtcataaccggc
tggggcgcgcttgagtacatccgcgacttggcggccgactacggattggccattcacggc
cacagggcgatgcacgcggccttcacgagggacaagtaccacggcatctcgatgttcgtc
ctggccaagctctacaggctcataggaattgaccagctccacgttggaaccgccggcgcc
ggaaagctcgagggcggaaaatgggacgtcatccagaacgcgaggattctcagggaggaa
acctacacccccgacgagaacgacgtcttccacctcgagcagaagttctacggcatgaag
gcagccttcccgaccagctcaggcggtctccacccgggcaacatcgagccggtcatagag
gccctcggaaaggacatagtcttacagctcggcggtggaactctcggccacccggacgga
ccgggagccggagcgagggcggtgagacaggccatcgacgccataatgcagggaatcccg
ctcgacgagtacgccaagacccacaaggagctcgctcgcgccctcgagaagtggggccac
gtcacgccggtctga

DBGET integrated database retrieval system