KEGG   Thermococcus nautili: BD01_1995Help
Entry
BD01_1995         CDS       T03065                                 

Definition
(GenBank) Aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tnu  Thermococcus nautili
Pathway
tnu00030  Pentose phosphate pathway
tnu01100  Metabolic pathways
tnu01120  Microbial metabolism in diverse environments
tnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BD01_1995
Enzymes [BR:tnu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     BD01_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AHL23595
UniProt: W8P7Q2
LinkDB All DBs
Position
complement(1751210..1753027)
Genome map
AA seq 605 aa AA seqDB search
MYAYWGKILRVNLTDGTIKEEHFDEKFAKKWLGTRGFGIYYLLKEMDPTVDPFSPDNKMI
FATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIVEGASDHPV
YIYINDESVEIRDASHLWGKTSSETEAALKEEIGDKRIRAALIGPAGENLVRFAAVMNDE
HRAAGRGGVGAVMGSKKLKAIVVRGHKRVEVADRAKFTSVVKEKTDKLRNDPTAGGGLPK
YGTAVLVNIINQNGLYPTRNFQYSQFEYAEEQSGEAMAAKYLVRNKPCYACPIGCGRVNR
LPTLGITEGPEYESIWALGAHNGINDLASIIEANHLADEYGMDTISLGGTLATAMELYEK
GLLKQEDLGEDAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGGYRLAEMYNGVEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGCHIKQYMISPEILGYPYKMDPHDISDEKVKMVI
LFQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDLSTEEYLKIGERIWNAERLFNL
KAGLDPLKEDTLPKRLLEEPVKNGPNKGHVVRLHLMLPKYYKFRGWTEDGKIPEEKLKEL
GLDEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcctactggggtaagattctgagggtgaacctgaccgatggaaccataaaggaa
gagcacttcgatgagaagttcgccaagaagtggctcggcacgaggggattcggcatatac
tacctcctcaaggagatggacccgaccgttgacccgttcagtccagataacaagatgatt
tttgccaccggtccgttgaccggaaccaccgctccaacgggcggaaggtacatggtgata
accaagagcccgctgacgggatacattgcaatggccaactccggcggcttcttcggagcg
gagctcaagttcgcgggctgggacgcgataatagttgaaggcgcttccgaccacccggtt
tacatctacatcaacgacgagagcgtagagattcgcgacgctagccacctctggggcaag
acctcaagcgagacagaggcggccctcaaggaggagataggcgacaagcgcatacgtgcg
gccctcataggacctgccggcgaaaacctcgtccgctttgccgctgtgatgaacgacgag
caccgtgccgccggtaggggtggcgttggagcggtcatgggaagcaagaagcttaaagcg
atagtcgtccgcggtcacaagcgcgttgaagttgccgacagggcgaagttcacgagcgtc
gtcaaggagaagaccgacaagctcaggaacgacccaactgccggcggtggactgcccaag
tacggaacagcagttctcgtcaacataatcaaccagaacggcctttacccgacgaggaac
ttccagtacagccagttcgagtacgcggaggagcagagcggtgaagctatggccgccaag
tacctcgtcagaaacaagccctgttacgcctgtccaatcggctgtggaagggttaacagg
cttccaacgctcggcatcaccgagggaccggagtacgagagcatctgggctttgggagct
cacaacggcataaacgacctcgcgagcatcatcgaggccaaccaccttgccgatgagtac
ggtatggacaccataagcctcggtggaactttggcaactgccatggagctctacgagaag
ggcctgctcaagcaggaggacctcggcgaggacgctccgcccttcaggtggggcaacacg
gaggtgctccactactacatcgagaagattgccaagagagagggcttcggtgacaagctg
gccgagggtggctacaggctcgccgagatgtacaacggcgtcgagtacttcatgggtgtc
aagaagcaggagcttccggcttacgacccgcgtggagccgagggccacggtctcggttac
gccaccaacaaccgcggtggctgtcacatcaagcagtacatgattagccccgagattctc
ggctacccgtacaagatggacccgcacgacataagcgacgagaaggtcaagatggtcata
ctcttccaggaccttacagcgctcatcgacgccgccggtctgtgtgtcttcaccaccttc
ggtctcggtgccgacgactaccgcgacatgctcaacgcggccctcggctgggacctctcg
accgaggagtacctcaagataggcgagcgcatctggaacgccgagaggctgttcaacctg
aaagcgggccttgacccgctcaaggaggacaccctgccgaagaggctcctcgaggagccc
gtcaagaacggaccgaacaagggccacgtcgtcaggctccacctgatgcttccgaagtac
tacaagttccgcggctggaccgaggacggcaagatacctgaggagaagctcaaggagctc
ggcctggacgagttgtaa

DBGET integrated database retrieval system