KEGG   Thermosediminibacter oceani: Toce_0656Help
Entry
Toce_0656         CDS       T01289                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00970  Aminoacyl-tRNA biosynthesis
toc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Toce_0656
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:toc03029]
    Toce_0656
Enzymes [BR:toc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Toce_0656
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Toce_0656
Mitochondrial biogenesis [BR:toc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Toce_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADL07428
UniProt: D9S201
LinkDB All DBs
Position
658086..659534
Genome map
AA seq 482 aa AA seqDB search
MKLYELTVHEARELLSKREISSEELTKAVLERIDQVEEKIRAFLTIDREGALEMSRKIDE
EADFSRTLAGIPGAIKDNICTKNLKTTCASKILGNFIPPYDATVSKKLKADNAVILGKTN
MDEFAMGSSTENSGFFITRNPWDLERVPGGSSGGSAAAVAAGECIFALGSDTGGSIRQPA
SYCGVVGLKPTYGRVSRYGLVAYASSLDQIGTITKDVTDCAIVLNAISGWDECDSTSVNM
PVPDYTESLVADVKGMKIGLPKEYLGEGIDKEVREAVLAAARTFESLGAVCEEISLPHTE
YALWAYYIIAPAEASSNLARYDGIRYGVRAVDYDDLIDLYKKTRSEGFGPEVKRRIMLGT
YALSSGYYDAYYLKAQKVRTLVKRDFDMAFEKYDVIISPTAPTAAFRIGEKTGDPLKMYM
SDVCTIPVNMAGLPAISVPCGFSNGMPVGLQIIGKAFDEATIIRAAYTFEQATDYHRKKP
VL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctgtacgaattgaccgtccatgaagcccgcgaactcctttcaaaaagggagatt
tcatccgaagagctgacaaaggcagtacttgaaagaatcgatcaagttgaagaaaagata
agggcgtttttaacaattgacagagaaggcgccctggaaatgagcagaaaaatagatgaa
gaagccgatttttccaggactttagccggaatccccggggctattaaggacaatatatgc
actaagaatttgaaaaccacctgtgcgtcaaaaattctcggtaatttcataccgccttat
gacgccacagtttcgaagaagttaaaggccgacaatgcggtaattctcggcaagaccaac
atggatgagtttgccatggggtcatccaccgaaaactcgggctttttcatcaccaggaac
ccgtgggacctggaaagggtgccgggaggttcctccggcggttcggcggccgccgttgcg
gcgggtgagtgcatattcgccctgggctccgatacgggaggttccatccgccagccggct
tcatactgcggcgttgttggcttgaaacctacatacggcagggtttcccgctacggcctg
gtggcctatgcgtcttcactggatcagataggcaccataacgaaggatgttacggactgc
gccatcgtgctcaacgcgatttccggttgggatgaatgcgattccacttccgtgaacatg
ccggtcccggactataccgaaagcctggttgccgatgtcaaaggcatgaagatcggactg
cccaaagaatacctgggagagggaatagacaaggaggtccgggaagcggttctggccgcc
gcgcgcactttcgagagcctgggggccgtctgcgaggaaatttcccttccgcataccgaa
tatgccctgtgggcttactacataatagccccggcggaagccagctcgaacctggcgcgt
tacgacggcataaggtacggcgtaagggctgtagattacgacgatctcatagacctttac
aagaaaacccgcagcgaaggtttcgggcccgaggtcaagcggaggatcatgctgggcact
tatgcgctgagttccggctattacgacgcgtactacctcaaggcccagaaggtaagaacc
ctggtgaaaagagattttgacatggctttcgagaagtacgacgtgataatttcacccacc
gccccgacagcagccttcaggataggggagaagaccggcgacccgcttaagatgtacatg
tcggacgtctgcacgatacccgtgaacatggcgggattaccggctatttccgtcccctgc
ggtttctcgaacgggatgcctgtaggacttcaaataataggaaaggctttcgatgaggcc
acaataataagggcggcttacacttttgaacaggctaccgattaccacagaaaaaagccc
gtgctttaa

DBGET integrated database retrieval system