KEGG   Thermosediminibacter oceani: Toce_0870Help
Entry
Toce_0870         CDS       T01289                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
toc  Thermosediminibacter oceani
Pathway
toc00010  Glycolysis / Gluconeogenesis
toc00030  Pentose phosphate pathway
toc00051  Fructose and mannose metabolism
toc00052  Galactose metabolism
toc00680  Methane metabolism
toc01100  Metabolic pathways
toc01110  Biosynthesis of secondary metabolites
toc01120  Microbial metabolism in diverse environments
toc01130  Biosynthesis of antibiotics
toc01200  Carbon metabolism
toc01230  Biosynthesis of amino acids
toc03018  RNA degradation
Module
toc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:toc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Toce_0870
   00030 Pentose phosphate pathway
    Toce_0870
   00051 Fructose and mannose metabolism
    Toce_0870
   00052 Galactose metabolism
    Toce_0870
  09102 Energy metabolism
   00680 Methane metabolism
    Toce_0870
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Toce_0870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:toc01009]
    Toce_0870
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:toc03019]
    Toce_0870
Enzymes [BR:toc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Toce_0870
Protein phosphatases and associated proteins [BR:toc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Toce_0870
Messenger RNA biogenesis [BR:toc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Toce_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADL07632
UniProt: D9S2K5
LinkDB All DBs
Position
861865..862824
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVVRSGIYNDMEVYGIRRGYAGLINGDFVKMDLGSVGDI
IHRGGTILRTARSEEFKTPEGMEKALKNIEALGLEGLVVIGGDGSFRGAIELSKRGVATI
GIPGTIDNDIPFTDYSIGFDTAVNTVVEAVNKIRDTATSHERTFIIEVMGRESGNLALYS
GVACGAETILVPEMPFTIKDVCEKIMSGFRRGKLHSIIILAEGAGQGFDVGREIKNITGF
ETRIIVLGHLQRGGTPTAFDRILASQMGGKAVELLKSGVSNKMVGWVKGELLVTDLEQIL
TTNKPFNMELYELANILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggattggaattctcactagtggtggagatgcccccgggatgaatgccgccata
agggcggtggtcagaagtggcatatacaatgatatggaggtttacggcattagaagaggc
tacgctggactgataaacggcgattttgtaaaaatggacctgggctcggtgggcgatata
atacaccgcggcggtaccattttgaggaccgcccgttctgaagaatttaaaactcccgaa
ggcatggaaaaggcgttaaaaaacatcgaagccctaggcctggaaggactggtcgttata
ggcggagacggctcctttagaggggcaatcgaactatccaaaagaggcgtggccacaata
ggcattccgggtaccatcgacaacgacatcccttttaccgattattcgataggttttgat
accgccgtcaataccgtggtagaagccgtaaacaagataagggatacggctacttcccat
gagaggacttttataatcgaggttatgggcagggaatccggcaatctcgccctgtattcg
ggcgtcgcctgcggtgctgaaaccattctcgtccccgaaatgccttttacgataaaagat
gtttgcgagaaaataatgagcggcttccgtaggggaaaactgcacagcattataatcctg
gccgaaggggccggtcaagggttcgatgtagggcgggagataaagaatataacgggtttt
gagaccaggataatagtccttgggcaccttcagagaggaggtacgccaacagcctttgac
cgcatactggccagccagatgggcggtaaagctgtggaacttctgaaaagcggtgtgagc
aacaagatggtgggatgggttaaaggagaactgctggtgacggatctggaacaaatactc
acaactaataaaccgtttaatatggaactatatgaactggcgaacatcctctctatttga

DBGET integrated database retrieval system