KEGG   Thermosediminibacter oceani: Toce_1054Help
Entry
Toce_1054         CDS       T01289                                 

Definition
(GenBank) degV family protein
Organism
toc  Thermosediminibacter oceani
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegV
Motif
Other DBs
NCBI-ProteinID: ADL07816
UniProt: D9S339
LinkDB All DBs
Position
1034416..1035252
Genome map
AA seq 278 aa AA seqDB search
MGSVKIVTDSTADLPPDMVERYEIGIVPLKIFFGDEEYRDGIDITPDEFYKKLRTSPHHP
RTSQPSPAEFVECYEKLATDATHLISIHLSSKLSGTYNSAIVAGSMVDIPVDAVDSQGAS
MVLGFMAIEAAKAAREGKQPGEILDKVEGLKKRIRIYFLVDTLEYLQKGGRIGRAAAFLG
NLLNIKPMLTFEDGLITPVERIRGKSKALNKLVEKVSQEAAKGPLTAAVVHSDCLEEALR
FKELIEERFEFRELYLTSLGCVLGAHTGPGLIGIVYYH
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgtaaaaatagtgaccgacagcacggcggacttaccgcccgatatggtggag
aggtacgaaatcggcatagtgccgttaaaaatatttttcggggatgaagaatacagggat
ggtattgatataacgcccgatgagttctataaaaagttgaggacatcgccccatcatccc
cgaacatcccagccgtctcctgccgagtttgtcgaatgctatgaaaaactggcaacggat
gctacgcacttaatttctatccacctgtctagtaaactgagcggaacctacaattccgcc
attgtggccgggagcatggttgatattccagtggatgcggtggattcacaaggagcgtcg
atggtactgggatttatggcaatagaagcggccaaagcggcccgggaaggtaaacaaccg
ggtgagatcctcgataaagtagagggtttgaaaaagagaatccggatatattttttggtg
gacacactcgagtacctgcaaaagggcggcaggataggaagagctgcggcgtttctcgga
aatctgctcaatataaaaccgatgcttacttttgaagacggcctgataactcctgtggaa
agaatccggggaaaatcaaaggcgctcaataagctggtggaaaaagtttctcaggaggcg
gccaaaggaccacttacggctgccgttgtacattccgattgccttgaggaagccttgcga
tttaaagaactcatcgaagaaagatttgaattcagagagctttacctcacttctctgggg
tgcgttctgggggctcacacagggccgggcctcataggaatcgtatattaccactag

DBGET integrated database retrieval system