KEGG   Tannerella sp. oral taxon HOT-286: BCB71_04155Help
Entry
BCB71_04155       CDS       T04474                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
toh  Tannerella sp. oral taxon HOT-286
Pathway
toh00500  Starch and sucrose metabolism
toh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:toh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCB71_04155
Enzymes [BR:toh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BCB71_04155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AOH41883
LinkDB All DBs
Position
1000553..1002670
Genome map
AA seq 705 aa AA seqDB search
MINRIQSVLLSLSFLMMSAWGLQAEDLKSPNGRLLMHFEVDGMGCPVYTLSYKGKPVIKR
SRLGLEAEGFSLREGFQLQKAETATFDETWKPVWGEVSSIRNHYNELAVTLHQPKDDRTI
RIRFRLYDDGLGFRYEFPEQKNLVYFVIKDEYSEFAMAGDHKAFWIPGDYDTQEYDYTES
HLSEIRKLMKAAVTFNTSQTPFSPTGVQTALMMKSADGLYINLHEAALVDYPCMSLELDD
KTMTFRSWLTPDAQGKKGYMQTPCQSPWRTIMVSDDAREILASKLTLNLNEPCALKDVSW
IKPVKYIGVWWEMITGKSTWAYTNDLLSVHIGVTDYTKVKPNGTHAANNDKVRRYIDFAA
KHGFDQVLVEGWNIGWEDWFGHSKDYVFDFLTPYPDFDIKALNEYAHSKGVKLMMHHETS
ASVRNYERHMEEAYQLMNKYGYNAVKSGYVGNIIPRGEHHYGQWMINHYLYAVKKAAEHH
IMVNAHEAVRPTGLCRTYPNLIGNEAARGGEYESFGGNKPFHTTILPFTRLMGGPMDYTP
GIFETRIKNVNPENNSFVHSTLARQLALFVTMYSPLQMAADLPENYERFMDAFQFIKDVA
VDWDDSKYLEAEPGRYITVARKAKGTNNWFVGCTASENGHMANISFDFLDPKRKYTATIY
ADGPTAHYEKNPQAYTIKKMTVTNKSRLTLRAASGGGFAISIIEQ
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcgtattcagagcgtgctcctctcgctctctttcttgatgatgtccgcttgg
ggcttgcaagcggaggatttgaagtcgcccaacggtcgattgctgatgcatttcgaagtg
gacggcatgggctgcccggtctataccttatcttataaggggaagccggtgattaaacgc
agtcggttgggcctcgaggcggagggcttctcgctgcgcgaaggtttccaactccaaaag
gcggagacagctactttcgacgagacttggaagcccgtctggggcgaggttagctccatc
cgcaaccattacaacgagctggccgtgacgctccatcagccgaaggacgaccggactatc
cgcatccgctttcgcctttacgacgatggtctcgggttccgctacgaattcccagagcaa
aagaacctcgtttacttcgttatcaaagacgaatactccgaatttgcgatggcgggagat
cataaagccttctggattccgggcgattatgacacgcaggaatatgattacaccgagtcg
cacctttccgagatccgtaagctaatgaaggcggccgtcacgttcaatacgtcgcagact
ccgttctctccgactggcgtacagacggcgctcatgatgaagtcagcagatggactttac
atcaacctgcatgaggcggcgctggtggattatccctgcatgtcgcttgagctggacgac
aagacgatgaccttccgctcttggttaacccccgacgcgcagggcaagaagggttatatg
cagacgccgtgccagtctccctggcgtacgatcatggtcagcgacgacgcgcgtgagatt
ctggcgtctaagttgacccttaacctcaacgaaccatgtgccttaaaagacgtctcatgg
atcaagccggtgaaatatatcggcgtttggtgggaaatgatcacgggcaaatcgacgtgg
gcctacaccaacgaccttctctcggtacacatcggcgtgacggactacaccaaggtcaag
cccaacggcacccacgcggcgaacaacgacaaagtgcgccgctatatcgacttcgccgcc
aagcacggcttcgatcaggtgctcgtcgagggctggaacatcgggtgggaggactggttt
ggccactctaaggactacgttttcgatttcctcaccccttaccccgactttgacatcaag
gcgctcaacgaatatgcccactcgaagggcgtcaagctgatgatgcaccacgagacctcc
gcctccgtccgcaattacgaacgccacatggaggaagcctatcaattgatgaacaaatac
ggctacaacgccgtcaagagtggctacgtgggcaacatcatcccacgcggcgaacatcac
tacgggcagtggatgatcaatcactacttatacgcggtgaagaaggccgccgagcaccac
atcatggtcaacgcccacgaggcggtgcgccccacgggcctctgtcgcacctatcccaac
ctgatcggtaacgaggcggcccgcggcggggaatacgaatcgtttggcggtaacaaaccg
ttccacaccaccatactcccctttacgcgcctcatgggcggcccgatggattacacaccg
ggcatctttgagacccgcattaagaacgtcaatccggagaacaattcgtttgtgcactcc
acgttggcccgccagctggccctcttcgtgacgatgtacagcccgctgcagatggcggcc
gacctgcccgaaaattatgagcgcttcatggacgccttccagttcatcaaagacgtggcc
gtggactgggacgactccaaatatctggaggctgagccggggcgctacatcaccgtggcc
cgcaaggccaagggcacgaacaactggttcgtaggctgcaccgcgagcgagaacggccac
atggctaacatctcgttcgacttcctcgaccccaagcgcaaatacacggctaccatctat
gccgacggtccgacggcgcattacgagaagaacccccaggcgtacaccattaagaagatg
accgtgacgaataagtcacgcctgaccctccgcgcggcctcgggcggcggatttgccatc
tcaattattgagcaataa

DBGET integrated database retrieval system