KEGG   Thalassolituus oleivorans MIL-1: TOL_0369
Entry
TOL_0369          CDS       T02529                                 

Definition
(GenBank) DotU
  KO
K11892  type VI secretion system protein ImpK
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
tol03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tol00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TOL_0369
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tol02044]
    TOL_0369
Secretion system [BR:tol02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TOL_0369
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CCU70811
UniProt: M5DN34
LinkDB
Position
397007..397888
AA seq 293 aa
MSGDRPIPGGADRTVIIPTPGAARGAQTPPPAAGNFGLQSNERIEIKTGLNPLVNSATTL
LTLVIKLRSTMQHANVPDLHKRLTEEIKAFESKTRNAGIAGDSVIAARYLLCSVIDEVVL
NTPWGASSGWSQHSLLSLFHQETSGGEKCFLILQRMLETPGIHLDVLELFYICLSLGFQG
KYRVVSGGGQQIEQIRDNLYKTIESHRPVPAHDLSPNWEGTVKAKDRMANFIPLWVFASV
VLAALLLTFSGFRYWLYQTTDPVASKIAAEMTTSEILEKNTVSPEPNTERRFY
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagcggtgatcgaccaattccaggcggcgctgaccgtacggttataattcctacgccg
ggagcggcacgcggcgcacaaacgccaccgcctgcggcaggaaattttggcttgcagtcg
aatgagcgtattgagattaagacaggcttaaatccattggttaattcagcaactaccttg
ctgacattggttattaagctgcgttcgaccatgcagcacgccaatgtaccggatttacac
aaacgccttaccgaggaaataaaagcatttgagagtaaaacccgtaatgccggtattgcc
ggtgatagcgttattgctgcacggtatttactctgttccgtcattgatgaagttgtattg
aatacgccgtggggcgcatcaagtggctggagtcagcattccttgctgagcctgtttcat
caagaaacatccggcggcgagaaatgctttttaattcttcagcgtatgttggaaacccca
ggcattcatttagatgtactggagttgttttacatttgtttaagtcttggttttcaaggt
aaatatcgtgttgtatctggcggcggccagcagattgagcaaattcgagataatttgtac
aagacaatagaaagtcatcgcccagtgccagcgcatgatttatcgcctaattgggaaggc
accgttaaggcaaaagatcgtatggcgaattttattccgctatgggtctttgccagcgtt
gtcttggcggctttgttgttaactttttctggctttcgttactggctgtatcagaccacc
gatcccgttgcgagtaagattgcggcagaaatgacgacgtccgaaatattagaaaaaaat
acagtttcaccagaaccaaacacggaaagacggttttattag

DBGET integrated database retrieval system