KEGG   Thalassolituus oleivorans MIL-1: TOL_0796Help
Entry
TOL_0796          CDS       T02529                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
tol00550  Peptidoglycan biosynthesis
tol01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tol00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TOL_0796
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    TOL_0796
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tol01011]
    TOL_0796
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tol03036]
    TOL_0796
Enzymes [BR:tol01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TOL_0796
Peptidoglycan biosynthesis and degradation proteins [BR:tol01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   TOL_0796
Chromosome and associated proteins [BR:tol03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    TOL_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CCU71234
UniProt: M5E0H4
LinkDB All DBs
Position
854038..855756
Genome map
AA seq 572 aa AA seqDB search
MTETSLEPQENSIVRWRFTLVLAVFALLLAVVLGRLVILHTVDQPFLFEQGEKRTVREEV
QPASRGMITDRFGTPLAVSTPVVTLWLNPQQVNIQQLPAIAKDLDIPAHTLVKSVERAAS
QGRSFIYLKRQVEPDVAEKVLARRVAGVYGDEDFRRFYPAAEITAHTVGIVNIDGKGQEG
LELAFDDYLRGHDGERKVVKDLYGNVIKQLEVNGVAENGPDMALTIDLRLQYLAYRELKA
AVQQHRAKSGSAVIVDAHTGEVLALVSQPSYNPNNRATLKPEDMRNRAIADLIEPGSTMK
PFTVAAALNSGRFFPSTQIDTSPGYVRVKNKTIRDHRDYGVLDITGIITKSSNVGVTYLA
HKLGAEVIWDFFTKAGIGQPGVLGFPGEAVGVLPYPEQLDSLRLATASFGYGLAVSPLQL
AQSYTAFAGGCRQSVRLIMRDEDKPACEPVMSAKVSRQILDMLETVTSDKGTGSRARVEG
YRVGGKTGTAHKVGRGGYEDSAYTAVFAGIAPISDPDLVLVVVIDEPQGQEYYGGEVAAP
VFSRIMGQALRLRQVAPDIPSKNTLQMAGGGA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacatcgctagaaccacaggaaaacagcattgttcgctggcgttttacgcta
gtgctagctgtgttcgccctgttgttagcggtggtgcttggtcgcttggttatattacac
actgtcgatcagccatttttgtttgaacaaggcgaaaagcgcacggtgcgtgaggaagtt
caaccggctagtcgcggcatgattacggatcgttttggtacaccactagcggtcagtaca
ccagtagtaacactttggttaaatcctcaacaagttaatatccagcagttaccagccatt
gctaaggatttggatattccagcgcatactttggtgaaaagcgttgagcgtgctgcatca
caagggcgttcattcatttatttgaagcgtcaggtggagcctgatgttgctgagaaagtt
ttggctcgccgtgttgccggtgtttacggtgatgaagattttcgtcgtttttacccggca
gcagaaattactgcgcacacagtcggtattgttaatattgatggaaaaggtcaagaaggt
ctggaattagcattcgacgattatctgcgcggacatgacggcgagcgcaaagttgttaaa
gatttatacggtaacgttattaagcaattagaagttaatggtgttgcagaaaatggccca
gatatggctttgaccattgatttgcgtttgcagtatttagcctatcgcgaattaaaagcc
gccgtgcagcagcatcgtgctaagtcaggtagtgctgttattgttgatgcgcacacaggt
gaagtattagcccttgtcagtcagccatcgtacaaccctaataatcgagcaacgttaaag
cccgaagatatgcgcaatagagctatcgccgatttaatcgaacccggttctaccatgaag
cccttcactgttgcagcggccctaaattccggccgcttttttccgtctacccagattgat
acgtcaccgggttatgtgcgcgtaaaaaataaaaccattcgtgatcaccgtgattacggt
gtgctagatattactggcattatcactaaatccagtaacgttggtgttacctatttagcc
cataaattaggtgccgaagttatttgggatttctttactaaggcgggtataggtcagccg
ggcgttttgggttttccgggtgaggctgtcggcgttttaccttatccagaacagttagat
tccttacggttggcaacggcatcgttcgggtatggtttggctgtctcgccattgcaactg
gcgcagtcatataccgcttttgctggtggatgccgtcagtctgtacggttaattatgcgc
gatgaagataaaccagcttgtgaacctgtgatgtcggcaaaagtatcccgtcaaattctc
gatatgttagagacagtaacaagcgacaaaggtactggtagtcgcgctcgtgttgagggt
tatcgcgttggcggtaaaacgggtacagctcataaagtcgggcgcggtggttatgaagat
tctgcatacactgctgtttttgccggtatcgcaccgatttcggacccagatttagtatta
gtggttgttattgatgaacctcaggggcaggaatattacggtggtgaagtagcggcaccg
gtattctctcgcatcatgggtcaggctttacgtttacgtcaggttgcgcctgatattcca
agtaaaaataccttacaaatggcaggaggtggagcatga

DBGET integrated database retrieval system