KEGG   Thalassolituus oleivorans MIL-1: TOL_1685Help
Entry
TOL_1685          CDS       T02529                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tol  Thalassolituus oleivorans MIL-1
Brite
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TOL_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: CCU72109
UniProt: M5E3N0
LinkDB All DBs
Position
complement(1817339..1818088)
Genome map
AA seq 249 aa AA seqDB search
MNDFNQNKRDFLATSATAAAGLLIASASNVSAAESSSQAAPKGANWMITEIKPKPLSFNA
AKLKGLSANLIESHWTNNYSGSVKTLNAVNDQLSQALANPDTPAFLYNDLKREHLIRTGS
VILHELYFDNLGGNGKADGELRSAFAKQFGTFDRWETEFRKIAQGLGGGSGWVVLGYNTH
FNKLENYWMGDHAHFPVGTVPLLVMDMYEHSYHMDFGAAAGKYIDAFFNNINWDEVAHRL
QATHTKTTS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattttaaccaaaacaaacgtgatttcctggctaccagtgcgaccgctgccgca
gggttgcttattgcatcggcatcaaatgttagcgcagctgaatcgtcgtctcaggcagca
cctaaaggagcaaattggatgatcaccgaaataaaaccaaaacctttatccttcaatgcc
gcaaaattaaaaggcctttctgccaatttgatcgagtcgcattggactaacaattacagc
ggttcggtaaaaacattgaatgcggtgaatgatcagttgagtcaggcactcgcaaacccc
gacacgccagcgtttctctacaatgatctcaagcgggagcatttgattcgcacaggctcg
gtcattttgcacgaattatattttgataacctgggcggtaatggcaaagccgatggtgaa
ttacgctcagctttcgccaaacaatttggtacttttgatcgctgggaaaccgaattccgc
aaaatcgctcaaggcttgggcggtggttccgggtgggttgttctggggtataacacgcat
ttcaataagctggaaaattattggatgggtgatcacgcacatttcccggtaggcacagtt
ccgttgttggtcatggatatgtatgaacattcttatcacatggactttggcgcggctgcc
ggtaaatatattgatgcttttttcaataatattaattgggatgaggttgctcatcggctc
caagccactcacacgaagacaacatcctaa

DBGET integrated database retrieval system