KEGG   Thalassolituus oleivorans MIL-1: TOL_3623Help
Entry
TOL_3623          CDS       T02529                                 

Definition
(GenBank) Malic enzyme, NAD-binding protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
tol  Thalassolituus oleivorans MIL-1
Pathway
tol00620  Pyruvate metabolism
tol01100  Metabolic pathways
tol01120  Microbial metabolism in diverse environments
tol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TOL_3623
Enzymes [BR:tol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     TOL_3623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M Malate_DH CO_deh_flav_C
Motif
Other DBs
NCBI-ProteinID: CCU74007
UniProt: M5DVZ3
LinkDB All DBs
Position
complement(3801170..3802432)
Genome map
AA seq 420 aa AA seqDB search
MSEDFKQAALDYHEFPKPGKISIELTTPAQTSRDLSLAYSPGVAEPVKAIAADPENAYRY
TAKGNLVAVITDGTAILGLGNLGPLASKPVMEGKSLLFKRFAGVDSIDIEVESESPQAFI
DTVRRIANTFGGINLEDIKAPECFEIERTLIEQCDIPVFHDDQHGTAIVTVAGAMNALEI
VGKKIEDAKMCVLGAGAAAISCSKLMILAGMKPENIFMCDRNGVIHSGRTDLNQYKAGFA
VETDKRTVDDALEGADIFLGLSGPNMVTGEQIKAMAKDPIIFACANPVPEIMPEIVSEVR
PDAIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKRINEEMKLAAAKALAGLAKEPVAQE
VLDAYGLESLEFGREYIIPKAVDTRLLGVVSSAVAKAAVDTGVASKPYPANYPLKTLADI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagatttcaaacaagcggcgttggattatcatgagtttccaaagccaggcaaa
atcagtattgaactgactacgccagctcaaacctcacgcgatttgtcgttggcctacagc
ccaggtgtggcagagccagtgaaggcaattgctgccgatcctgaaaatgcttaccgttat
acagcgaaaggtaacttggttgctgttattactgatggtacggcgattcttggtttgggt
aacttaggtccattggcttccaaaccagtaatggaaggcaagagtcttctgttcaagcgt
tttgctggtgttgactcaatcgatattgaagttgaatcagaaagcccacaagctttcatc
gacaccgttcgtcgtattgccaatacttttggcggcattaaccttgaagatatcaaggcg
cctgagtgttttgaaattgaacgcactttgatcgaacaatgcgacatcccagtattccat
gatgaccaacacggtacggctatcgtaaccgttgccggtgctatgaatgcactggaaatt
gttggcaaaaagatcgaagacgcaaaaatgtgcgtacttggtgccggtgctgccgcaatt
tcttgctctaaattgatgattttggcgggtatgaagccagagaacatcttcatgtgtgac
cgtaatggcgtgatccattctggccgtactgatttgaaccaatataaagccggtttcgcg
gttgagactgacaagcgcacagtggatgatgcacttgaaggtgcagacatctttttgggt
ttatctggccctaacatggtgactggcgaacagatcaaagcaatggctaaagatccaatc
atctttgcttgcgcaaacccagttccagaaatcatgcctgaaatcgtgagcgaagttcgt
ccagatgcgattatggcaactggtcgttcagactacccgaaccaggttaacaacgttctt
ggcttcccattcatcttccgtggtgcattagacgtgcgtgctaagcgtattaacgaagag
atgaagttggctgcagcaaaagcattggctggtttggcgaaagaaccagtagctcaggaa
gtgttggatgcctatggcttagaatctttagaattcggccgcgaatacatcattcctaaa
gcggttgatactcgcttgttgggtgtggtttcttcggctgttgctaaagcagcagttgat
actggggtggcatcaaagccttacccagcaaactacccactgaaaactttggcagatatc
taa

DBGET integrated database retrieval system