KEGG   Tateyamaria omphalii: BWR18_03135Help
Entry
BWR18_03135       CDS       T04652                                 

Definition
(GenBank) dimethlysulfonioproprionate lyase DddL
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
tom  Tateyamaria omphalii
Pathway
tom00920  Sulfur metabolism
tom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BWR18_03135
Enzymes [BR:tom01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     BWR18_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7 Cupin_2
Motif
Other DBs
NCBI-ProteinID: APX10797
UniProt: A0A1P8MRU1
LinkDB All DBs
Position
648483..649139
Genome map
AA seq 218 aa AA seqDB search
MSDRSTLKDHPDWTYVLRDSYDFYRRQSAGGSAKIRTHQRSVRERINRVIKANAEVRFPE
PADKPVTQHLRRALDNGRMERHAPFIRSLDAIRHRLTWQYGYEKVPRGLERKFAYAELVG
PSGPVITNEVILGLVLFAPACTYPAHAHDGITESYICLSGAVSENDQGVYGPGSLIFNPP
EQLHRITVADHVPALLFYAWEGAPEKLAQQKMVFTRKR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccgctctaccctcaaggaccacccggactggacctatgtcctgcgcgacagc
tacgatttttaccgccgtcagtctgcgggcggcagtgccaagatccggacccatcagcgc
agtgtgcgggaacgcatcaaccgggtgatcaaggcgaatgccgaggtgcgctttcccgaa
cctgccgataagcccgtcacccagcacctgcgccgcgcgctcgacaatggacggatggag
cggcacgcgcccttcatccgctcgctggatgcgatccggcaccggctgacctggcaatac
ggatatgaaaaagtgccgcgcgggttggaacggaagtttgcgtatgcggaattggtcggg
ccgagcgggccggtgatcacgaacgaggtgatcctggggctggtcctgtttgcccccgcc
tgcacctatcctgcgcacgcccatgacggcatcacggaaagctacatctgcctgtcgggg
gctgtgtccgagaacgatcagggtgtctacggccccggctcgctgatcttcaacccgccg
gagcagttgcaccgcatcacggtcgccgaccatgtgcctgcgcttctgttctatgcgtgg
gagggcgcgccggagaaactggcgcagcagaagatggtgtttacgcgcaagcggtga

DBGET integrated database retrieval system