KEGG   Tateyamaria omphalii: BWR18_03395Help
Entry
BWR18_03395       CDS       T04652                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
tom  Tateyamaria omphalii
Pathway
tom00061  Fatty acid biosynthesis
tom00780  Biotin metabolism
tom01100  Metabolic pathways
tom01130  Biosynthesis of antibiotics
tom01212  Fatty acid metabolism
Module
tom_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BWR18_03395
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BWR18_03395
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BWR18_03395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tom01004]
    BWR18_03395
Enzymes [BR:tom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BWR18_03395
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BWR18_03395
Lipid biosynthesis proteins [BR:tom01004]
 Fatty acid synthase
  Component type
   BWR18_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: APX10844
UniProt: A0A1P8MS43
LinkDB All DBs
Position
complement(697616..698407)
Genome map
AA seq 263 aa AA seqDB search
MTGLLTGKRGLVMGVANDRSIAWGIAKALHGAGAELAFTYQGEAFGKRLEPLAASVGSDF
MVDVDVTDDASLDAAFEGLQARWPTIDFLVHAIAYSDKSELTGRFLNTSRSNFKHSMEIS
AYSFVEVARRAHPMMVDNGGTLLTLTYLGSNRVVPNYNVMGVAKAALESATRYLANDLGP
EGIRVNAISPGPMKTLAGSAIAGARKTYKHTDQNAPMRSNATLDAVGGTAVYLCSDAGAC
TTGEVIRVDGGFHVLGMPQPDHL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgggattgctgacaggaaaacgcggccttgtgatgggcgtggccaacgaccggtcg
attgcgtggggcattgccaaagcgctgcacggggccggggccgaacttgcctttacctac
cagggtgaagctttcggcaagcggctcgaaccgctggcggcaagtgtcggctcggacttc
atggtcgatgtggacgtcaccgatgacgcgtcactggatgccgcattcgagggcttgcag
gcgcgctggccgaccatcgactttctggtccatgccattgcctattccgacaagtcggaa
ctgacgggccggttcctgaacaccagccggtcgaacttcaagcattccatggaaatctcc
gcctattcctttgtcgaggtcgcgcgccgcgcgcatccgatgatggtcgacaatggcggt
acacttctgacgctcacctacctggggtcgaaccgtgttgtgccaaactacaacgtcatg
ggcgttgccaaggcagcactggaatctgccacgcgctatctggccaacgatctgggcccc
gaagggattcgtgtgaacgccatctcgcccggcccgatgaaaacgctggcgggctccgcc
attgcaggcgcgcgcaagacctacaagcacacggaccagaacgcgccgatgcggtcaaac
gcaacgctcgatgctgtgggcggaacggctgtatatctgtgctccgatgcgggggcctgc
accacgggcgaagtcatacgcgtcgacggcggcttccacgtgctgggcatgccgcagcct
gatcacctctag

DBGET integrated database retrieval system