KEGG   Tateyamaria omphalii: BWR18_09180Help
Entry
BWR18_09180       CDS       T04652                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tom  Tateyamaria omphalii
Pathway
tom00473  D-Alanine metabolism
tom00550  Peptidoglycan biosynthesis
tom01100  Metabolic pathways
tom01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BWR18_09180
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BWR18_09180
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BWR18_09180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tom01011]
    BWR18_09180
Enzymes [BR:tom01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BWR18_09180
Peptidoglycan biosynthesis and degradation proteins [BR:tom01011]
 Precursor biosynthesis
  Amino acid ligase
   BWR18_09180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: APX11832
UniProt: A0A1P8MV03
LinkDB All DBs
Position
complement(1850824..1851744)
Genome map
AA seq 306 aa AA seqDB search
MAGQSSRRSKVAVLLGGPSAEREVSLSTGQACAAALRDMGYQVVEVDAGPDLCAVLQDIS
PDAVLNCLHGRWGEDGCVQGILEWLGIPYSHSGVLASALAMDKQRSKDVFRTEGLPVVDS
VICPKADVMAGHVMAPPYVIKPNNEGSSVGVYLVHEGSNGPPKLDDQMPDHVMVEAYADG
RELTTTVMGDRALGVTDIITDGWYDYDAKYKPGGSRHEIPANVPEEISDLCLNYALRAHR
ALGCRGVSRTDFRWDESKGAAGLILLETNTQPGMTATSLTPEQAQAVGMSFGELCAWMVE
DASCNR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagtcgagcagacgttccaaagtggcggtgttattgggtggcccctcggct
gagcgcgaggtgtctttgtcaacgggacaggcctgcgcagccgcgctgagggacatggga
taccaagtggtcgaggtcgatgcgggccccgacctttgtgccgttttgcaggacatttca
cccgacgccgttctgaattgccttcatggccgttggggcgaggacggctgtgtgcagggt
atccttgaatggctgggcataccctattcccattcaggtgttcttgcctcggctcttgcg
atggacaagcagcgcagcaaggacgtgttccggaccgagggcttgcccgtcgtggacagc
gtgatctgtcccaaggctgacgtgatggccgggcatgtcatggcgccaccttatgtgatc
aagccaaacaatgaagggtcgagcgttggtgtgtacctcgtccacgaggggtcaaatggt
ccgccgaagctggacgaccagatgccggaccatgtcatggtcgaggcctacgccgatggc
cgtgagctgacgaccaccgtgatgggcgatcgcgcgttgggtgtgaccgatatcatcacc
gacggctggtacgattatgatgccaagtacaagccgggcgggtcgcggcacgagattccg
gccaatgtgcccgaagagatttcagacctctgcctgaactatgccctgcgggcgcatcgg
gcgctgggctgccgaggggtgagccgcaccgattttcgctgggacgagagcaaaggggct
gctggcctgatcctgctggagacgaacacgcagccgggcatgaccgcaacctcgctcacg
cccgaacaggcgcaggcggtgggcatgagctttggcgagctgtgtgcctggatggtggag
gacgcgtcgtgcaacaggtga

DBGET integrated database retrieval system