KEGG   Tateyamaria omphalii: BWR18_11320Help
Entry
BWR18_11320       CDS       T04652                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
tom  Tateyamaria omphalii
Pathway
tom00240  Pyrimidine metabolism
tom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BWR18_11320
Enzymes [BR:tom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BWR18_11320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 RuvB_C
Motif
Other DBs
NCBI-ProteinID: APX12204
UniProt: A0A1P8MVW9
LinkDB All DBs
Position
2293849..2294430
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQAAHNYRERGMEPYLLTASFDDRAGQGRIASRIGIGAEAD
TFTTQEDLFAKVTTRQGAGPIVCVFVDEAQFLTEDQVWQLARVVDDLHVPVMSYGLRVDF
RGKLFPGSAALLALADEMREVRTICHCGRKATMVIRQDAHGNVITDGAQVQIGGNETYVS
LCRQHWRAAVGDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctactttcactactccaccatgaacgccggcaaatcgaccgtgcttttg
caagccgcgcacaactaccgcgaacgcggcatggaaccgtacctgctgaccgcatccttt
gacgaccgggcgggccaggggcgcatcgcctcgcgcatcggcatcggcgcagaggccgac
accttcaccacgcaagaggaccttttcgccaaagtgacgacgcggcagggcgcaggcccg
attgtctgcgtcttcgtggacgaggcgcaatttctcaccgaagatcaggtctggcaactc
gcccgcgtcgtggatgacctgcacgtgccggtcatgtcctacggcctgcgggtcgatttc
cggggcaaactgtttccaggctcagccgccctgctcgcgctcgcggacgagatgcgcgaa
gtgcgcaccatctgccattgcgggcgcaaggcgaccatggtgatccggcaggatgcgcac
ggcaacgtcataaccgacggcgcgcaggtacaaatcgggggcaacgaaacctatgtctcg
ctctgccgccagcattggcgggccgccgtgggcgacctttag

DBGET integrated database retrieval system