KEGG   Tateyamaria omphalii: BWR18_13810Help
Entry
BWR18_13810       CDS       T04652                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
tom  Tateyamaria omphalii
Pathway
tom02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tom00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BWR18_13810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tom02000]
    BWR18_13810
Enzymes [BR:tom01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BWR18_13810
Transporters [BR:tom02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BWR18_13810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 Rad17 AAA_22 RsgA_GTPase SMC_N AAA_15 AAA_23 AAA_16 AAA_29 AAA_30 AAA_33 AAA_28 NB-ARC AAA_18
Motif
Other DBs
NCBI-ProteinID: APX12639
UniProt: A0A1P8MXJ6
LinkDB All DBs
Position
complement(2785456..2786271)
Genome map
AA seq 271 aa AA seqDB search
MFDAQTTKVTPSASQGRNSPPIMTVRNLSLHYGDKQALDDVSFDLYSNEILAFIGPSGCG
KSTALKCLNRMHDDTRGVRTCGTILMEGEDINGPDVDPPLHRRRFGWVAQKPNPFPTSIY
ENVAYAARLHGLTPNRQALKEHVKQCLSRAGLWDEVEEHLYKKSGTDLSGGQQQRLCIAR
ALATQPDVLLMDEPTGSIDPIATARIEDLLLELKQDQAIVIITHSMAQARRIADRVAYFH
LGKLLEVQDTEAMFTAPATPEARAFIEGKMG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacgcccaaacgaccaaggtgacgccctctgccagccaagggcgcaacagccca
ccgatcatgacggtccggaacctgtcgctgcattatggtgacaagcaggcgctggatgat
gtcagtttcgacctttattcaaacgagatcctcgcctttatcggcccctccgggtgcggg
aaatccacggcgctgaagtgcttgaaccgtatgcacgacgacacgcgcggcgtgcggacc
tgcggcacgatcctgatggagggcgaggatatcaacggccccgatgtcgacccgccgctg
caccgccgccgctttggctgggtggcgcagaagcccaatccatttcccacgtcgatctat
gaaaacgtcgcttatgcggcgcgtctgcatgggttgacgccgaaccggcaggcgctgaaa
gagcatgtgaaacagtgccttagccgtgcgggcctatgggacgaagtggaagagcatctg
tacaagaaatctggcacggacctgtctggcgggcagcagcagcggttgtgcatcgcccgc
gcgctggcgacgcagccggatgtgctgttgatggacgagcccacggggtccatcgacccg
atcgccaccgcccggatcgaggatctactgctggaactgaagcaggatcaggccatcgtc
atcatcacccattcgatggcgcaggcgcgccgcattgcggaccgggtcgcctatttccac
ttggggaaattgcttgaggtgcaggacaccgaagcgatgttcacagcccccgcaacaccc
gaggcgcgggcgttcatcgagggcaagatggggtga

DBGET integrated database retrieval system