KEGG   Tateyamaria omphalii: BWR18_16985Help
Entry
BWR18_16985       CDS       T04652                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
tom  Tateyamaria omphalii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_2 HI0933_like Sacchrp_dh_NADP DAO ADH_zinc_N_2 NAD_binding_8 FAD_oxidored FAD_binding_3 Pyr_redox_3 3HCDH_N TrkA_N NAD_binding_7 UDPG_MGDP_dh_N 2-Hacid_dh_C GIDA CMAS
Motif
Other DBs
NCBI-ProteinID: APX13189
UniProt: A0A1P8MZ62
LinkDB All DBs
Position
3390230..3391261
Genome map
AA seq 343 aa AA seqDB search
MTHQAAFYRGDKHFSVEAVETPGPGPGHVQIDVAYCGICGTDLHIYLGHMDARVGFERTI
GHEMSGVVSAVGDGVEGLAPGQNIVVRPLDHCGHCPACKAGHQHICHNLKFIGIDSDGAF
QQKWNVPAHTVHVLPAGLNLAHAALIEPLAVAVHDVDRGRVQPGEDVLVIGGGPIGMLVA
MAARHAGANVTVAEINDNRLAFAQSVGFTTMDPKTTDVAKAMHEATDGKGADVVFEVSGS
QPGVDLMTAASATRGRIVMVAIHATKPQIDMFQFFWRELDLIGARVYRPEDYDKAMDLLA
QGVVDCDAFITDIQGLDDIEGAFKMLTENPNAMKSMIRVTEGL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcaggcagcgttctaccgcggcgacaaacacttctcggtcgaagcggtagaa
acacccggccccggccccggccacgtgcaaatcgacgtcgcctattgcgggatctgcggc
accgacctgcatatctacctcggccacatggacgcgcgcgtcggctttgagcggaccatc
gggcacgaaatgtccggcgtggtgtcagccgtgggcgacggcgtcgaggggctcgcgccc
ggtcaaaacatcgtcgtccgccccctcgaccattgcggtcactgccccgcctgcaaagcg
ggccaccaacacatctgccacaacctcaaattcatcggcatcgacagcgacggcgccttt
caacagaaatggaacgtcccggctcacaccgtccacgttctgcccgcaggcctcaacctc
gcgcacgccgccctcatcgaacctctggctgtcgccgttcacgacgtggaccggggcagg
gtgcaaccgggcgaggacgttctggtcatcggcggcgggcccatcggcatgctcgtcgcc
atggccgcgcgccacgcaggcgccaacgtcacggtggctgaaatcaacgacaaccgcctc
gccttcgcccaaagcgtcggcttcaccaccatggaccccaaaaccaccgatgtcgccaaa
gccatgcacgaagccacggacggcaagggcgccgacgtcgtcttcgaggtgtccggcagc
caacccggcgttgacctgatgaccgctgcctctgccacacgggggcgtatcgtgatggtt
gccatccacgccaccaaaccgcaaatcgacatgttccaattcttctggcgcgagctggac
ctgatcggcgcccgcgtctacaggcctgaggattacgacaaggccatggacttgctcgcc
cagggcgtcgtcgattgcgacgccttcatcacagacattcaggggctggatgatatcgag
ggtgccttcaaaatgctcaccgaaaacccaaacgccatgaaatccatgatccgcgtgacg
gagggtctgtaa

DBGET integrated database retrieval system