KEGG   Tateyamaria omphalii: BWR18_16985
Entry
BWR18_16985       CDS       T04652                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tom  Tateyamaria omphalii
Pathway
tom00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BWR18_16985
Enzymes [BR:tom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BWR18_16985
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BWR18_16985
    1.1.1.-  
     BWR18_16985
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_2 HI0933_like DAO Sacchrp_dh_NADP ADH_zinc_N_2 FAD_oxidored NAD_binding_8 FAD_binding_3 Pyr_redox_3 3HCDH_N TrkA_N NAD_binding_7 UDPG_MGDP_dh_N 2-Hacid_dh_C GIDA CMAS
Other DBs
NCBI-ProteinID: APX13189
UniProt: A0A1P8MZ62
LinkDB
Position
3390230..3391261
AA seq 343 aa
MTHQAAFYRGDKHFSVEAVETPGPGPGHVQIDVAYCGICGTDLHIYLGHMDARVGFERTI
GHEMSGVVSAVGDGVEGLAPGQNIVVRPLDHCGHCPACKAGHQHICHNLKFIGIDSDGAF
QQKWNVPAHTVHVLPAGLNLAHAALIEPLAVAVHDVDRGRVQPGEDVLVIGGGPIGMLVA
MAARHAGANVTVAEINDNRLAFAQSVGFTTMDPKTTDVAKAMHEATDGKGADVVFEVSGS
QPGVDLMTAASATRGRIVMVAIHATKPQIDMFQFFWRELDLIGARVYRPEDYDKAMDLLA
QGVVDCDAFITDIQGLDDIEGAFKMLTENPNAMKSMIRVTEGL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgacgcatcaggcagcgttctaccgcggcgacaaacacttctcggtcgaagcggtagaa
acacccggccccggccccggccacgtgcaaatcgacgtcgcctattgcgggatctgcggc
accgacctgcatatctacctcggccacatggacgcgcgcgtcggctttgagcggaccatc
gggcacgaaatgtccggcgtggtgtcagccgtgggcgacggcgtcgaggggctcgcgccc
ggtcaaaacatcgtcgtccgccccctcgaccattgcggtcactgccccgcctgcaaagcg
ggccaccaacacatctgccacaacctcaaattcatcggcatcgacagcgacggcgccttt
caacagaaatggaacgtcccggctcacaccgtccacgttctgcccgcaggcctcaacctc
gcgcacgccgccctcatcgaacctctggctgtcgccgttcacgacgtggaccggggcagg
gtgcaaccgggcgaggacgttctggtcatcggcggcgggcccatcggcatgctcgtcgcc
atggccgcgcgccacgcaggcgccaacgtcacggtggctgaaatcaacgacaaccgcctc
gccttcgcccaaagcgtcggcttcaccaccatggaccccaaaaccaccgatgtcgccaaa
gccatgcacgaagccacggacggcaagggcgccgacgtcgtcttcgaggtgtccggcagc
caacccggcgttgacctgatgaccgctgcctctgccacacgggggcgtatcgtgatggtt
gccatccacgccaccaaaccgcaaatcgacatgttccaattcttctggcgcgagctggac
ctgatcggcgcccgcgtctacaggcctgaggattacgacaaggccatggacttgctcgcc
cagggcgtcgtcgattgcgacgccttcatcacagacattcaggggctggatgatatcgag
ggtgccttcaaaatgctcaccgaaaacccaaacgccatgaaatccatgatccgcgtgacg
gagggtctgtaa

DBGET integrated database retrieval system