KEGG   Thermococcus onnurineus: TON_0397Help
Entry
TON_0397          CDS       T00789                                 

Definition
(GenBank) threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ton  Thermococcus onnurineus
Pathway
ton00260  Glycine, serine and threonine metabolism
ton01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ton00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TON_0397
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TON_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ACJ15882
UniProt: B6YTJ5
LinkDB All DBs
Position
complement(369632..370684)
Genome map
AA seq 350 aa AA seqDB search
MAEKMPAIVKTKPAYGAELVEVDIPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVIEVGPGVDTINVGDYISAETHIVCGKCYACKHNRYHVCQNTKIFGVD
MDGVFAEYAIVPAQNAWKNPKDMPPEYATLQEPLGNAVDTVLAGPIAGRSTLITGAGPLG
LLGIAVAKASGAYPVIVSEPSEFRRELAKKVGADYVVNPFEEDPVKFVMDITDGAGVEVF
LEFSGAPKAFEQGLQAVTPGGRVSLLGLFPREVTFDINNLVIFKALEVHGITGRHLWETW
YTVSSLIQSGKLNLDPIITHKYKGFDKFEEAFELMRAGKTGKVVFFPHKK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaagatgccggcgatcgttaagacgaagcccgcctacggtgcggagctcgtt
gaagttgatatccccaagcccggtcctggagaggttctcatcaaggttcttgccaccagt
atctgtggaactgacctgcacatctatgaatggaacgaatgggcgcagagcaggatcaaa
ccgccccagataatgggtcacgaagtcgccggagaggtcatcgaggttggtcccggcgtt
gatacaatcaatgttggtgattacatttcagctgagactcacatagtctgtggaaaatgt
tacgcctgcaagcacaatcgctaccacgtctgccagaacacaaagatattcggcgttgac
atggacggtgtctttgccgaatacgctatagttcccgcccagaacgcttggaagaatccg
aaagacatgcctcccgagtatgcaaccctccaagagccccttggaaacgccgttgataca
gttcttgctggtccaatagctggaaggagcacgcttatcacaggcgcaggtccgctcggt
ctcctaggtatagccgttgctaaggccagtggcgcttatcctgtcatcgtcagcgagcca
agcgagtttagacgcgagctagcaaagaaagttggtgctgactacgttgtcaaccccttc
gaagaggatccagttaagttcgttatggacataactgatggagccggtgttgaagtcttt
ctcgagttcagcggcgctcctaaggccttcgaacagggcctccaggcggtaacaccggga
ggaagggtctcgttgctcggcctcttcccgagagaggtcacctttgacatcaacaacctc
gtaatcttcaaggcccttgaagtacacggaataaccggaaggcacctctgggagacctgg
tacaccgtttcgagccttattcagagcggcaagctcaacctcgatccaataataacccac
aagtacaagggcttcgacaagtttgaggaagcctttgagctcatgcgcgccggcaagact
ggaaaggtcgtcttcttcccccacaagaagtga

DBGET integrated database retrieval system