KEGG   Thermococcus onnurineus: TON_1017Help
Entry
TON_1017          CDS       T00789                                 

Definition
(GenBank) 4Fe-4S ferredoxin, iron-sulfur binding domain protein
  KO
K00196  anaerobic carbon-monoxide dehydrogenase iron sulfur subunit
Organism
ton  Thermococcus onnurineus
Pathway
ton00633  Nitrotoluene degradation
ton00680  Methane metabolism
ton00720  Carbon fixation pathways in prokaryotes
ton01100  Metabolic pathways
ton01120  Microbial metabolism in diverse environments
ton01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TON_1017
   00680 Methane metabolism
    TON_1017
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TON_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_9 Fer4_10 Fer4_16 Fer4_4 Fer4_3 Fer4_21 Fer4_17 Fer4_20 Fe_dep_repr_C Fer4_8
Motif
Other DBs
NCBI-ProteinID: ACJ16505
UniProt: B6YWP2
LinkDB All DBs
Position
940254..940892
Genome map
AA seq 212 aa AA seqDB search
MPAFSGSNMEKLTIYINPERCTGCRACEIACAVEHSMSKNLFGAIFEKPTPKPRLQVVVA
DFFNVPMRCQHCEDAPCMEACPTGAISRTKEGFVVLNANKCIGCLMCVMACPFGHPKFEP
EYKAVIKCDSCVDRVREGKEPACVEACPTRALKFGTLGEILEEVRKEKAESLISGLKSQG
MVYMKPVSESKKKEDLVRPMDLYLAYSNVVWY
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccagctttttccggttccaacatggagaagcttacaatttacataaatccagagaga
tgcacggggtgcagggcctgcgaaattgcctgtgcagttgaacattcaatgagcaaaaac
ctctttggcgcaatttttgaaaaaccaacccccaaaccccgactccaagttgttgtcgcc
gacttctttaatgttccaatgagatgccagcactgtgaggacgctccctgtatggaggcc
tgcccaacaggagcgatctcaaggaccaaagaaggctttgttgtccttaacgccaacaag
tgcataggctgtctcatgtgtgtgatggcctgtccatttggccatcccaagttcgagccc
gaatacaaggctgtgataaaatgcgacagttgtgttgatagggtcagagaaggcaaagag
ccagcatgtgtcgaggcctgtccaactagagccctgaagttcgggactctcggcgaaata
ctggaagaggttagaaaggagaaggcagagagtctcatatctgggctgaaatcgcagggg
atggtctacatgaagcccgtctccgagtcaaagaagaaagaggatcttgttagacctatg
gatctgtatcttgcctattcaaatgtagtgtggtattga

DBGET integrated database retrieval system