KEGG   Thermococcus onnurineus: TON_1234Help
Entry
TON_1234          CDS       T00789                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase, typeIII
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ton  Thermococcus onnurineus
Pathway
ton00630  Glyoxylate and dicarboxylate metabolism
ton01100  Metabolic pathways
ton01120  Microbial metabolism in diverse environments
ton01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TON_1234
Enzymes [BR:ton01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TON_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ACJ16722
UniProt: B6YXA9
LinkDB All DBs
Position
complement(1125429..1126763)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKSYEPNKKRDIIAVFRITPAEGYTIEQVAGGVAAESSTGTWTTLYN
WYEEERWADLSAKAYDFIDMGDGSWIVKIAYPFHAFEEANLPGLLASIAGNVFGMRRAKG
LRLEDMYFPEKLIREFSGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLSYEL
LLNGADYMKDDENLTSPWYNRFEERAETIAKIIEKVESETGEKKTWFANITADVREMERR
LEILADLGLKHAMVDVVITGWGALEYIRDLAADYGLAIHGHRAMHATFTRNPYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILREEHYKPDENDVFHLEQKFYSIK
PAFPTSSGGLHPGNLPIVIDALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDALVQGIP
LDEYAKTHKELARALEKWGHVTPI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaagtttgacaagatatatgactactacgtggacaagagctacgaacccaac
aagaagagggacatcatagccgtattccgcataacccctgctgagggatataccatcgag
caggtggccggaggtgtggccgccgaaagctcgacgggaacttggacgacgctctacaac
tggtacgaggaggagcgctgggccgacctttcagctaaggcctatgacttcattgacatg
ggtgacggctcatggatagttaagatcgcttatccgttccacgccttcgaggaggccaac
cttccgggacttctcgcgagcatagccggaaacgtctttggaatgaggcgtgccaagggg
ctgcgccttgaggacatgtacttcccggagaagctcatcagagagttcagcggtccggct
tttggtatcgagggcgtcaggaagatgcttgagatcaaggaccggcccatctacggtgtc
gttcccaagccgaaggtcggctactccccggaggagtttgagaagctttcctatgagctt
cttctcaatggggccgactacatgaaggacgacgagaacctcaccagcccatggtacaac
cgctttgaggagagggctgagaccatcgccaagatcatcgagaaggttgagagcgagacc
ggcgagaagaagacttggttcgccaacataacagctgacgttagggagatggagcgcagg
ctggaaatcttggctgacctcggcctcaagcacgcgatggttgacgtcgtcataaccggt
tggggagcccttgaatacatccgcgacctcgcggcagactacggtctggccattcacggc
cacagggcaatgcacgcgaccttcaccaggaacccctaccacggcatctcgatgttcgtc
ctggcgaagctctacaggctcatcggtatcgaccagctccacgttggaaccgctggagct
ggcaagcttgagggtggcaagtgggacgtcatacagaacgccagaatccttagggaggag
cactacaagcccgacgagaacgacgtcttccacctggagcagaagttctacagcataaag
ccagccttcccgaccagctcaggcggcctgcacccgggcaacctgccgatagtcatagac
gcccttggaaccgacatagtcctccagctcggcggtggaaccctcggccatccggacggg
cctgccgctggagcgagagcagtgaggcaggctatcgatgccctcgtccagggtataccg
ctcgacgagtacgccaagacccacaaggagctcgcaagggcattggagaagtggggccac
gtcaccccaatctga

DBGET integrated database retrieval system