KEGG   Thermococcus onnurineus: TON_1354Help
Entry
TON_1354          CDS       T00789                                 

Definition
(GenBank) aor-2 tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ton  Thermococcus onnurineus
Pathway
ton00030  Pentose phosphate pathway
ton01100  Metabolic pathways
ton01120  Microbial metabolism in diverse environments
ton01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ton00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TON_1354
Enzymes [BR:ton01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TON_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACJ16844
UniProt: B6YXN1
LinkDB All DBs
Position
1223352..1225169
Genome map
AA seq 605 aa AA seqDB search
MFAYWGRILRVNLSTGKISEEKFDEKFAQKWLGTRGFGIYYLLKEIDPTVDPFSPENKII
YATGPLTGTTAPTGGRYMVITKSPLTGYIAMANSGGFFGAELKFAGWDAIIVEGKADHPV
YIYINDDQVEIRDASHLWGKLVSETEEKLREEVGDKRVRIASIGPAGENLVRFAAVMNDE
HRAAGRGGVGAVMGSKNLKAIVVRGHKRVEIADRAKFTSVVKEKIDKLRNDPVAGGGLPK
YGTAVLVNIINQNGLYPTRNFQDSQFEYAEEQSGEAMTAKYLIRNKPCYACPIGCGRVNK
LPTVGVTEGPEYESIWALGAHLGINDLASIIEANHMIDELGMDTISTGGTLATAMELFEK
GLIKPEDLGEEAPPFRWGNTEVLHYYIEKIARREGFGDKLAEGGYRLAEMYNGTEYFMGV
KKQELPAYDPRGAEGHGLGYATNNRGGGHIKQYMISPEILGYPYKMDPHDISDEKVKMVI
IFQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDLTTEEYLKIGERIWNAERLFNL
KAGLDPLKEDTLPKRLLEEPVKQGPNKGRVVRLKEMLPRYYALRGWTEDGRIPEEKLEEL
GLNEF
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcatactggggaagaattttgagggttaacctaagcacaggcaaaatcagtgaa
gagaagttcgacgaaaagtttgcccagaagtggcttggaaccagaggatttggtatctac
tacctcctgaaggagatagacccaacggttgacccattcagccctgaaaacaaaataata
tacgccaccggcccgttgactggaaccactgccccaactggcggcagatacatggttata
accaagagcccactgactggctatatagccatggccaactccggtggcttcttcggagcc
gagctgaagttcgctggctgggacgctataatagtcgagggcaaggctgatcacccggtt
tacatatacataaacgacgaccaggttgaaatcagggatgcaagccacctctggggcaag
ctcgtgagcgagaccgaagagaaactcagggaagaagtcggcgacaagagggttcgcatc
gcctcaataggcccggcaggtgagaacctcgtccgcttcgctgcggtaatgaacgacgag
cacagggcagccggaagaggtggcgttggagccgtcatgggaagcaagaacctcaaggcg
atagtcgttcgcggccacaagagggttgagatcgccgacagggccaagttcaccagcgta
gtgaaggagaagatcgacaagctgaggaacgatcctgttgctggcggtggactgcccaag
tatggtaccgcagttcttgtcaatataatcaaccagaatggcctctacccgaccaggaac
ttccaggacagccagtttgagtacgccgaagagcagagcggtgaggccatgaccgccaaa
tacctcatcaggaataagccctgttacgcctgtccgatcggctgtggaagggtcaacaag
cttccaaccgtaggagtcaccgaaggtcccgaatacgagagcatctgggcgctcggagcg
cacctcggaataaacgacctggcaagcattatagaggctaaccacatgatagacgagctc
ggtatggacaccatttcaaccggtggaaccctcgccactgccatggagctcttcgagaag
ggcctaatcaagcctgaggatctcggcgaggaggctccgcccttcaggtggggcaacacc
gaggttctgcactactacatcgagaagatagccaggagagagggcttcggtgacaagctc
gccgagggtggctacaggcttgccgagatgtacaacggcaccgagtacttcatgggcgtc
aagaagcaggagcttccggcctacgacccgaggggtgcagagggccatggccttggttac
gctaccaacaaccgtggcggcggccacattaagcagtacatgataagtccggagatactt
ggctacccatacaagatggatccacacgacattagcgacgagaaggttaagatggtcata
atcttccaggatcttaccgcgttgatagacgccgcgggtctgtgtgtattcacaaccttc
ggacttggtgcggacgactaccgcgacatgcttaatgcagctctcggatgggacctcact
accgaggagtacctcaagatcggagagcgcatctggaacgcagagaggctcttcaacctc
aaggctggcctcgatccactcaaggaggacaccctgcccaagaggctcctcgaggagccc
gtcaagcagggtccgaataagggaagggtcgtcaggctcaaggagatgcttccgaggtac
tatgcactccgcggctggaccgaggatggaagaattcccgaggagaagctcgaggagctc
ggcctgaacgagttctga

DBGET integrated database retrieval system