KEGG   Thermococcus onnurineus: TON_1515Help
Entry
TON_1515          CDS       T00789                                 

Definition
(GenBank) thermostable DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ton  Thermococcus onnurineus
Pathway
ton03030  DNA replication
ton03410  Base excision repair
ton03420  Nucleotide excision repair
ton03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ton00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TON_1515
   03410 Base excision repair
    TON_1515
   03420 Nucleotide excision repair
    TON_1515
   03430 Mismatch repair
    TON_1515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ton03032]
    TON_1515
   03400 DNA repair and recombination proteins [BR:ton03400]
    TON_1515
Enzymes [BR:ton01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TON_1515
    6.5.1.6  DNA ligase (ATP or NAD+)
     TON_1515
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     TON_1515
DNA replication proteins [BR:ton03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    TON_1515
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     TON_1515
DNA repair and recombination proteins [BR:ton03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     TON_1515
   NER (nucleotide excision repair)
    Other NER factors
     TON_1515
   MMR (mismatch exicision repair)
    Other MMR factors
     TON_1515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 TPR_1
Motif
Other DBs
NCBI-ProteinID: ACJ17005
UniProt: B6YTR4
LinkDB All DBs
Position
complement(1390140..1391828)
Genome map
AA seq 562 aa AA seqDB search
MGDMKYTELSDLYRRLEKTTLKTLKTKFVADFLKKTPDELLEVVPYLILGKVFPDWDERE
LGVGEKLLIKAVSMATGVQEREIENSVKDTGDLGESVALALKKKKQKSFFSQPLTIKRVY
QTFIKIAEASGEGSQDRKLKYLANIFMDAQPEEGKYIARTVLGMMRTGVAEGILRDAIAE
AFKVKAELVERAYMLTSDFGYVAKVAKLEGNDGLGKVHIQIGKPIRPMLAQNAASVKEAL
LEMGAEAAFEIKYDGARVQVHKDGDRVVIYSRRLENVTRSIPEVVDAIKASIKSEKAIVE
GELVAVGEGGRPRPFQYVLRRFRRKYNIEEMIEKIPLELNLFDVLYVDGEPLIDTPFRER
RAKLEEIVEEGEKLKLAQQLVTKKVEEAEEFYKKALELGHEGLMAKRLDSVYEPGNRGKK
WLKIKPTMEDLDLVIIGAEWGEGRRAHLLGSFLVAAYDPHSGEFVPVGKVGSGFTDEDLV
EFTKMLKPLIIGGEGKFVEIEPKVVIQVTYQEIQKSPKYRSGFALRFPRYVALREDKSPE
EADTIERIAQLYEFQERFKAKK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgggagacatgaaatacactgaactctctgacctttaccgcaggctcgagaagactacc
ctcaaaacgctcaagactaagttcgtggccgactttctgaagaaaactccagatgagctt
ctcgaggtggtcccatacctgattcttggtaaggtctttcccgattgggacgagagggag
cttggtgttggtgagaagctcctcataaaggccgtatctatggcaaccggtgttcaggag
agggaaatagagaactcagtcaaggacacgggagatctgggcgagagcgttgccttggca
ttaaagaaaaagaagcagaagagcttcttcagccagccgctcacgataaagcgcgtttat
cagactttcattaagatagccgaagcgagtggcgagggaagccaggacaggaagctgaag
tacctcgcaaacatcttcatggacgcccagccggaagagggtaaatacatagcaagaacc
gttctcggcatgatgagaacgggcgttgccgagggcatacttcgcgatgccatagccgag
gccttcaaagtcaaagccgagctcgttgagcgtgcctacatgctcacgagcgacttcggc
tacgttgcaaaggtggcgaagctcgaaggcaacgatggcctagggaaggttcacattcag
attgggaagccgataaggccgatgctcgcccagaacgcggcgagcgtcaaggaggccctc
ctcgagatgggcgccgaggcggcattcgagataaagtacgatggagcgagagttcaggtt
cacaaggacggcgacagggttgtaatctactccaggcggctggagaacgtcacgcgctct
atccccgaggtcgttgatgccataaaggcgagcataaagtccgaaaaagcgatagttgag
ggtgagcttgtcgctgtgggtgagggtggaaggccaagacccttccagtatgtcctcagg
cgcttcaggaggaaatacaacatcgaagagatgatagagaagatcccgctggagctcaac
cttttcgacgtcctctacgtcgatggagaacccctgatcgacacccccttccgcgagagg
agagctaagcttgaagaaatcgtcgaggagggcgaaaagctcaagcttgcccagcaactg
gtcacgaagaaggtcgaggaggccgaggagttctacaagaaggcccttgaacttggccat
gagggtctcatggcgaagagactcgattccgtctacgagcccggaaacaggggcaagaag
tggctcaagataaagcccaccatggaagatctcgaccttgtcataattggggcggagtgg
ggcgagggaaggagggcacacctgctcggctccttcctggttgcggcctatgacccgcac
agcggtgagtttgtgccggtcgggaaggttggcagcggcttcaccgatgaagacctcgtt
gagttcaccaagatgctcaagcccctcatcatcggtggtgagggcaaattcgtggagatt
gagccgaaggtggtcatccaggtcacctaccaggagatacagaagagtccgaagtacagg
agcgggtttgcgctgaggttcccgcgctacgtggctctgagagaggataaaagtcctgaa
gaggccgacacgatagagcgcatcgcccagctctacgagttccaggagaggttcaaggct
aaaaagtga

DBGET integrated database retrieval system