KEGG   Tetragenococcus osmophilus: C7K38_08405Help
Entry
C7K38_08405       CDS       T05711                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
too  Tetragenococcus osmophilus
Pathway
too00061  Fatty acid biosynthesis
too00620  Pyruvate metabolism
too00640  Propanoate metabolism
too01100  Metabolic pathways
too01110  Biosynthesis of secondary metabolites
too01120  Microbial metabolism in diverse environments
too01130  Biosynthesis of antibiotics
too01200  Carbon metabolism
too01212  Fatty acid metabolism
Module
too_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:too00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C7K38_08405
   00640 Propanoate metabolism
    C7K38_08405
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C7K38_08405
Enzymes [BR:too01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     C7K38_08405
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     C7K38_08405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATPgrasp_ST ATP-grasp_5 ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AYW48385
UniProt: A0A3G5FDG8
LinkDB All DBs
Position
1714724..1716088
Genome map
AA seq 454 aa AA seqDB search
MFSKILVANRGEIAVRIIRACRELGIHTVAVYSEADKDALHAELADEAICIGPARSSDSY
LNVQQILSAAHVTKAEAIHPGFGFLSENARFAEMCEEMNVVFIGPKSKTIDDMGNKINAR
KLMRAANVPVVPGSPGAISDVNEAVQIADEIGFPIMLKAAAGGGGKGIRKIYNKEDLPQS
FASAQQEANAAFGDDSMYIEKIVYPARHIEIQILADNFGHVIHLGERDCSLQRNNQKVLE
ESPSVVIDEQKRQEIGMTAVKAAQAVDYCNAGTIEFLMDEEGNFYFMEMNTRIQVEHPIT
EMVTGIDIVKKQLEIASGRELTIEQEAVQFNGHAIECRINAENPNFNFAPSPGKIENLLL
PAGGLGVRVESAMYSGYTIPPYYDSMIAKVIAYADTRFEALMKMQRALSELVTDGVVTNA
EFQLDLISHPKVLSGDYNTAFLQEEFLPNWTPED
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaagattttagttgcaaaccgtggagaaatcgcggtacggattatacgtgct
tgtcgtgaattaggtattcatactgttgctgtttattcagaagctgacaaagatgctttg
catgctgaattagctgatgaagcgatttgtattggccccgcacgctcctcagattcttat
ttaaatgtccagcaaattttaagtgcagctcatgtaacaaaggcagaagcgatccatcca
ggctttggttttttatcagaaaatgctcgctttgctgagatgtgtgaagaaatgaatgtt
gtttttatcggtcccaaaagtaaaacaattgatgatatgggcaacaaaatcaacgctaga
aaattgatgagagctgctaatgtccccgttgttccaggcagtcctggagcgattagtgat
gtaaacgaagctgtacaaattgctgatgagattggttttcccatcatgttaaaagctgct
gccggtggcggtggcaaagggattcgtaaaatctataataaagaagatttaccgcaaagt
tttgcttctgcacaacaagaggctaacgcagcttttggcgatgattcaatgtatattgaa
aagattgtttatccagcacggcatattgaaattcaaattctagccgataatttcggtcat
gtgatacacttaggcgaaagagattgttcattacagcgtaataatcaaaaagtcttagaa
gaatctccttctgtagtaattgatgaacaaaaacgccaagaaattggcatgactgcagtc
aaagctgcccaagctgtggattattgtaatgctggtacaattgaatttttaatggatgaa
gagggaaatttctatttcatggaaatgaacacccgaattcaagtagaacatccaatcaca
gaaatggtcacaggcattgatattgtaaaaaaacaattagagattgctagtggtcgagaa
ttaacgattgaacaagaagctgtgcaattcaatgggcatgcgattgaatgccgtattaat
gcggaaaatccaaactttaattttgcgccatctcctggtaaaatcgaaaacttattgtta
ccagctggagggttaggcgtacgtgttgaaagtgcgatgtattctggttatacaatcccc
ccttattacgattcgatgattgctaaagttattgcttatgcagatacgcgttttgaagcg
ttgatgaaaatgcaacgagcattaagcgaacttgtgacagatggtgttgtaacgaatgct
gaatttcaattagatttaatcagtcatcccaaagtactttctggcgattacaataccgcc
tttttacaagaagaatttttaccgaattggacacctgaagactag

DBGET integrated database retrieval system