KEGG   Tetragenococcus osmophilus: C7K38_08450Help
Entry
C7K38_08450       CDS       T05711                                 

Definition
(GenBank) hypothetical protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
too  Tetragenococcus osmophilus
Pathway
too02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:too00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C7K38_08450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:too02000]
    C7K38_08450
   02035 Bacterial motility proteins [BR:too02035]
    C7K38_08450
Transporters [BR:too02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    C7K38_08450
Bacterial motility proteins [BR:too02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    C7K38_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: AYW48393
UniProt: A0A3G5FDJ3
LinkDB All DBs
Position
1722098..1722937
Genome map
AA seq 279 aa AA seqDB search
MKKGRLLGKLTALAAVSLVFLTACQNQGASEEDLAATDSSADQETEVLRFGITGGYPPIN
YHDEDTEELVGYEVDMAKELVKDLDGDVEAEFVEMSFGSILESLNSDRINVAMHSLSETP
ERAEQYDFTVPYFDKVWGIIVAEDSDIQTLDDLDGKRAAQSVSTSSGQEAEELGGELVPI
DDVDEAVKLITEDRADFYLGSDVGQQDYLDKQPEPLPVRVLDETVQDVPASLVVPKGSDE
LREALNESIIENTEDGTLAEIYDEYLDMDKSIEDFDEDE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggacgtttattaggaaaattgacggcattagcggctgtatcattggtattt
ttaactgcttgccaaaatcaaggagcttcagaagaagatttagcggctactgattcttcc
gcagatcaagagactgaagtgcttcgatttgggattacgggcggctatccaccaattaat
tatcatgatgaagataccgaggagttagttggttatgaggtcgatatggccaaagaactt
gtcaaagacttagatggtgatgtggaagcagagtttgtggaaatgtcttttggttccatt
ttggagagtttaaatagcgatcgtattaatgtagcgatgcatagcttgagtgaaacacca
gaacgggcagaacagtatgatttcaccgtcccttattttgacaaagtatgggggattatt
gtggctgaagatagcgacattcaaaccttagatgatctagacggcaagcgggcggcccaa
agtgtgtcgacttcatctggacaagaggcagaagaacttggcggagaacttgtcccaatt
gacgatgtggacgaagcggttaaattgattacagaagatcgtgcggatttttatctaggt
agcgatgtcggccaacaagactatttagataaacaaccggaaccattacctgttcgtgtg
ttagatgaaaccgtgcaagatgtacctgcttctttggttgtgccaaaaggctcagatgag
ttaagagaggctttaaatgaatcaattatcgaaaatacagaagatggaactttagctgaa
atttatgacgaatatttagatatggataaatccatcgaagattttgatgaagacgaataa

DBGET integrated database retrieval system