KEGG   Tetragenococcus osmophilus: C7K38_09845Help
Entry
C7K38_09845       CDS       T05711                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
too  Tetragenococcus osmophilus
Pathway
too00970  Aminoacyl-tRNA biosynthesis
too01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:too00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C7K38_09845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:too03029]
    C7K38_09845
Enzymes [BR:too01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C7K38_09845
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C7K38_09845
Mitochondrial biogenesis [BR:too03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C7K38_09845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AYW48647
UniProt: A0A3G5FE72
LinkDB All DBs
Position
complement(2030840..2032270)
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTNTKIFSPAPAHFGAEPNSNTNVIDWGYPGVLPVMNKSALEYGM
KAALALNCDISQETHFDRKNYFYPDNPKAYQISQFDEPIGHNGWIEIDVEGQKKKIRIER
VHLEEDAGKNTHGNDGYSYVDLNRQGTPLIEIVSEADMRSPEEAYAYLDALRSIIQFTGV
SDVKMEEGSLRCDANISLRPLGQEEFGIKTELKNLNSLNFVRKGLAFEEKRQAKLLLSGG
SLQQETRRFDEASGETVLMRVKEGSSDYRYFPEPDIPRFEIDDAWIKSVEETLPEMPKDR
RKRYVNELGLPEYDAKVLTLTKEMSDFFEETIQQGADAKQASNWLMGDVSAYLNSEKIDL
ADTQLTPNNLAGMIQLINDGTISSKIAKKVFQELIEHGGDPNEVVEANGWIQLSDPAQLL
PMINEVLDNNQQSIDDFKNGKDKAIGFLVGQIMKATKGKANPGVVNKLLKEELEKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaaactgtgatcggacttgaagtccatgtagaattaaaaaccaatacgaag
atattttctcctgctcctgctcattttggagcagaaccaaatagtaataccaatgtcatc
gactggggatacccaggggttttgcctgtgatgaataagtctgctttagaatatgggatg
aaagctgctttagcgttaaattgtgatatttcacaagaaacacattttgatcgtaaaaat
tatttttatccagataatcctaaagcttatcaaatttcccaatttgatgaacctattgga
cataatggttggattgaaattgatgttgaaggacaaaagaaaaagatccgtattgagcgt
gttcacttagaagaagatgcagggaaaaatacgcacggaaacgatggctattcttacgtt
gacttaaatcgccaaggaactccgttaatcgaaattgtctcagaagcagacatgcgttct
cctgaggaagcttatgcttacttagatgctttgcgttcgattattcaatttaccggagtc
tctgatgttaaaatggaagaaggatcattgcgttgtgatgcgaatatttccttacgacct
ttaggacaagaagaatttggaatcaaaacagaactgaaaaacttaaattcgcttaacttt
gtaagaaaaggactagcttttgaagaaaaacgacaagcaaaacttttattatctggtggc
tccttacaacaagaaacacgtcgctttgatgaagcttcaggagaaacagtgctaatgcga
gtcaaagaaggttcttctgattatcgttatttcccagaaccagatattccacgctttgaa
attgatgatgcatggattaaaagcgtagaagaaactttaccagaaatgccaaaggatcgt
cgcaagcgttatgtaaatgaacttggtttgccagaatacgatgcaaaggtacttactcta
acaaaagaaatgtctgatttctttgaagaaactattcagcaaggggcagatgctaaacaa
gcttctaactggctaatgggagatgtttctgcctatttgaacagcgaaaagatagactta
gctgatacacaattaacgccaaacaatttggcaggtatgatacaacttattaacgatggt
acaatcagttccaagattgctaaaaaagtatttcaagaattaattgaacatgggggagac
cctaatgaagttgtcgaagcaaatggttggatacaattatcagatccagcacaattattg
ccaatgattaatgaagttttagataataaccaacaatctattgatgactttaaaaatggg
aaagacaaagcgattggctttttagttggccaaatcatgaaagcaactaaaggaaaagcc
aatcctggtgtggtaaacaagttgttaaaagaagaattagaaaaacgataa

DBGET integrated database retrieval system