KEGG   Thermodesulfobacterium geofontis: TOPB45_0507
Entry
TOPB45_0507       CDS       T01547                                 

Definition
(GenBank) glycosyl transferase family 2
Organism
top  Thermodesulfobacterium geofontis
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 TPR_2 TPR_12 Pribosyltran
Other DBs
NCBI-ProteinID: AEH22609
UniProt: F8C4A8
LinkDB
Position
513603..514499
AA seq 298 aa
MSNYKLSILIPTYNRLDLFKETLNSILPQAQGKPVHIAIVDDGSTEGNYEYALELSKKYP
FIEIARHEKNLGVGVARNTLLGLAKGDYLIFFDSDDLLLDRGLEKMLDLIDSEIAEVYVL
NTYREKGKKLKFKIFPEDKTEKKLLKAFLEGKFSEALYLVKSDIAKKFSFSSNLRVMEDL
PYQGKLILHSKIKIINQPFAIKRDHPQRLRKVSDYYFQNAIDAIEDLFKRLPSEYQCFKP
FAYAKTYLDLGKRAYLNSDLAKAKDFLKKAIECYPKIRKDFKYWKLRFKILFKNFLKK
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagtaattataaactttccattcttatccctacttacaatcggctggatctttttaaa
gaaacccttaattcaatccttccacaagctcaaggaaaacctgtgcatatagctatagtt
gatgatggctcaaccgaaggaaactatgagtatgctttagagttaagtaagaaatatccc
tttattgaaatagcgaggcatgaaaagaacttgggggttggagtagcaagaaataccctt
cttggattagctaaaggagattatttaattttctttgattctgatgacttacttcttgat
aggggtttagagaaaatgttagatcttattgattctgaaattgctgaggtttatgtttta
aatacttaccgtgagaaaggaaaaaagctaaagtttaaaattttcccagaggataaaaca
gaaaaaaaactacttaaagcttttcttgaggggaaattttctgaagctttatatttagtg
aaatctgatatagcaaaaaagttttccttttcttccaatttaagagttatggaggattta
ccttatcaaggaaaattgattcttcattccaaaataaaaataattaatcaaccttttgct
ataaaaagagatcaccctcaaagattaagaaaggtttcagattattattttcaaaatgcc
atagatgcaattgaagacctttttaagagactcccttctgagtatcaatgctttaagcct
tttgcctatgctaaaacttatcttgaccttgggaaaagagcttatttaaatagtgattta
gcaaaggctaaagattttcttaagaaggcaatagaatgctatccaaaaataagaaaagat
tttaaatattggaagcttaggtttaaaatcctcttcaaaaattttttgaaaaaatga

DBGET integrated database retrieval system