KEGG   Thermodesulfobacterium geofontis: TOPB45_0977Help
Entry
TOPB45_0977       CDS       T01547                                 

Definition
(GenBank) Y414 protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
top  Thermodesulfobacterium geofontis
Brite
Enzymes [BR:top01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TOPB45_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AEH23072
UniProt: F8C5T4
LinkDB All DBs
Position
962637..963791
Genome map
AA seq 384 aa AA seqDB search
MKEEEKEILRYLKYCWETNVYLRKYPLKDWEDAYYKGKVLFFSWKNKNFFRLNKDFKFYP
LGTFFNEKILVLGYPHIPRIYVLKTGLKRYLKYPFYAEEKIEGYNVRLVKVDDEILAFTR
RGYVCAFATDRWEDFLPELPRFFEENPDLVVCAEVAGPENPFVSEYPSYIKEDINFFVFD
FMKKGEGEFLNVSKKLELLKKYRLNSPEIQGPFDPEKDYQKIKELLKRYHLEKREGVVFK
PDYEGNRVKYVTPFSNLEDLRVVFPYLGEIDPYFVSLRLIRLALNLYEFEEFKEEVYSVL
GKNLFEETLENFKTERLLQETFRVRFKKESNFHAMLAHFRIAKVSIEVKKTEWKNGYFCV
EFSKIYPKATQFWKSKLEGWGEID
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaagaggaaaaagagatattaagatatttgaaatactgttgggagacaaatgtt
tatttaagaaaatatcctctaaaagactgggaagatgcctattacaaaggaaaggtttta
ttttttagttggaaaaataaaaatttctttagactcaataaagactttaaattttatccc
ctggggactttttttaatgaaaaaattttagttctcggctatccacatatcccaagaatt
tatgtattaaaaactgggcttaaaagatatcttaaatatcccttttatgctgaagaaaaa
attgaaggatataatgttaggttagtaaaggttgatgatgaaatccttgcttttacaaga
agaggatatgtatgtgcttttgctactgatagatgggaagattttttacctgagcttcca
aggttttttgaggaaaatcctgatttagtagtttgtgcagaagttgcaggacctgaaaat
ccctttgtaagtgagtatccatcttatataaaagaggatattaatttttttgtatttgat
tttatgaagaaaggggaaggagaatttttaaatgtatctaaaaaattagagcttttaaaa
aaatatagattaaattctcctgaaatacaaggaccctttgatccagagaaagattaccaa
aaaataaaagaacttctcaaaaggtatcatttagaaaaaagagaaggtgtagtttttaaa
ccagattatgaaggaaatagagttaaatatgtaactcccttttctaatcttgaggattta
agggtagtttttccctatctcggagagatagatccctattttgtatctttaagattgata
agacttgcactaaatctttatgagtttgaagaatttaaagaagaagtttatagtgtttta
ggaaaaaatttatttgaagaaactttagaaaattttaaaacagaaagacttttgcaagaa
acttttagagtaagatttaaaaaggaaagtaattttcatgctatgcttgcacattttcgt
atagctaaagtgagtatagaagttaaaaaaacagaatggaaaaatggatatttttgtgta
gaattttctaaaatatatccaaaggcaacccaattttggaagtctaaattagaggggtgg
ggagaaattgattaa

DBGET integrated database retrieval system