KEGG   Tolypothrix sp. PCC 7910: HCG51_25465
Entry
HCG51_25465       CDS       T06504                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
toq  Tolypothrix sp. PCC 7910
Pathway
toq00010  Glycolysis / Gluconeogenesis
toq00020  Citrate cycle (TCA cycle)
toq00620  Pyruvate metabolism
toq01100  Metabolic pathways
toq01110  Biosynthesis of secondary metabolites
toq01120  Microbial metabolism in diverse environments
toq01200  Carbon metabolism
Module
toq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:toq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCG51_25465
   00020 Citrate cycle (TCA cycle)
    HCG51_25465
   00620 Pyruvate metabolism
    HCG51_25465
Enzymes [BR:toq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HCG51_25465
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase Redoxin MadL GCV_H
Other DBs
NCBI-ProteinID: QIR39727
UniProt: A0A6G9SN39
LinkDB
Position
complement(6379891..6381204)
AA seq 437 aa
MSIYEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
LVQAGESAAVGNAIAFVVETEAEIEAAKAAANSSSAATPAPAAPQPVAAAVSAGTPVLAS
QNGSNHKEGRLVVSPRARKLAKELKVDLKTLQGSGPYGRIVAEDVEAAANKGKPAASAPI
TPPPSVPTTAPVAPPAKTAAPAAAPVPAVASAVPGQVVPLTTFQNAVVRNMVATLSVPVF
RVGYTITTDALDKLYKQVKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINI
SVAVAMDDGGLITPVLKNADIVDLYSLSRSWKSLVERARAKQLQPDEYNSGTFTVSNLGM
FGVDTFDAILPPGQGSILAIGASRPQVVATADGLFGVRQQMQVNITSDHRIIYGAHAAAF
LQDLAKLIETNPQSLTM
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgagcatttacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcttgggtaaagtctccaggcgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttctatgaaggatatctggctcacatt
ttagtgcaagctggtgaaagtgcggctgtaggaaatgcgatcgctttcgttgtagaaacg
gaagctgaaatcgaagctgctaaggctgctgctaattctagtagcgctgctactcctgct
cctgctgcgcctcaaccagtcgccgccgctgtttctgctggaacaccagtcttagcgtct
caaaacggctcaaaccacaaagaaggaaggctcgtagtttctccacgggcccgcaaattg
gcaaaagagttaaaagttgatttaaagacgcttcaaggcagtggcccctacggtcgtatt
gttgctgaagatgtggaagctgctgcaaataaaggtaagccagccgctagcgcaccaatt
acaccgccaccatctgtaccaacaaccgctccagttgcaccaccagctaagacggctgca
cctgcagctgcgcctgttcccgcagttgctagcgctgtccctggtcaggtagtacctcta
actactttccaaaatgcagtagtacggaatatggtagctaccttatctgtacctgttttc
cgtgtgggttacacaattaccaccgatgcactagacaagctctataagcaggtgaagtcc
aaaggggtaacaatgacagcgctactggcaaaagccgtagcagtaacgttgcaaaaacac
ccgctactcaatgctagctattccgatcaaggaattgtttatcattctgacatcaacatt
tccgtagctgtagcaatggatgatggcggattgattacacctgtattaaagaatgcagac
atagtagatctttattccctatcccgcagttggaagtctttagtagaacgtgctagagca
aaacaactgcaaccagacgaatacaacagtggcacatttaccgtgtccaacttggggatg
tttggtgtagatacatttgatgcaattttaccacctgggcaaggttcaattttagcgatt
ggtgcatcccgtccgcaagttgtagcaaccgctgatggtttgtttggggtacgtcaacaa
atgcaggtaaatattacttcagaccatcgtattatttacggtgctcatgctgctgcattc
ttgcaagatttagctaagttgattgagactaatccacaatctttgactatgtaa

DBGET integrated database retrieval system