KEGG   Thalassolituus oleivorans R6-15: R615_03120Help
Entry
R615_03120        CDS       T03056                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00550  Peptidoglycan biosynthesis
tor01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    R615_03120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    R615_03120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tor01011]
    R615_03120
Enzymes [BR:tor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     R615_03120
Peptidoglycan biosynthesis and degradation proteins [BR:tor01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   R615_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1319
Motif
Other DBs
NCBI-ProteinID: AHK15025
UniProt: W8FVB6
LinkDB All DBs
Position
complement(673848..675701)
Genome map
AA seq 617 aa AA seqDB search
MWEHSFRDKTAERRLFRARAITLGLFIFIMLCGLAWRMSYLQIELHEKYKNLSENNRVQL
RPLAPNRGLIYDRNGVLLAENIPSYSLTIVAERVRDLDQTLTFLNDLIEISERDREQFDK
RLKFRRRPFEPVVLRYRLSEEEIAKVLVNRFYLPGVDVEAQLVRHYPNGNAFAHVLGYVG
RINEKDQALLDTDPDVKRRYSATQYIGKTGVERRYEEDLHGEVGYQKVETNARGRILSVI
EQQDPIPGKDLTLHLDARLQKLAEKEMTGRRGAVVAIEVATGGIVALYSNPAFDPNSFVT
GISHKDYSDLRDDPDQPLFDRATRGQYPPASTLKPFIGLAALNAGTTNWNDSIRDQGWYK
LDNDERLYRDWKRGGHGRVDLERAVVESCDTYFYDVAVRTGIDGITPFLAQFGFGRDMTL
DVISALPGLLPDRDWKKAHRRGSWYAGDTVNLGIGQGFMLTTPLQLATATAVLANRGKWQ
IPRLIYAHNEVEDVIEHGDIPDIQLRNPDNWNRMFNAMANVVSGQHGTARRLLSNMQFPM
AAKTGTAQVVGIKQDEEYDSEALRERLRDHALFIAFAPVDNPQIAIAVIVENGESAGKTA
GPIAQSIINEYLGGAEG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagcactcgttcagggataagacagcagaacgacgtctgtttcgcgcgcgcgct
atcactttaggtctgtttattttcatcatgctgtgcggcttagcttggcgcatgtcgtac
ctgcagattgaactgcacgaaaaatacaaaaacctctctgaaaacaaccgcgttcaatta
cggccgctcgcccccaatcgaggccttatttacgaccgcaacggcgtgttgttagcagaa
aatatcccttcttacagcctcaccattgtcgccgaacgcgtaagagatctcgatcaaacc
ttaacctttctcaacgatctcattgaaatatccgaacgtgaccgtgaacaattcgacaag
cgtctaaagtttcgccgtcgtccgtttgagcctgtggttttacgttatcgtctgagtgaa
gaagaaattgccaaagtattggtgaatcgtttttatctaccgggcgtcgatgtagaagca
caactcgtgcgtcactatcccaatggtaatgcctttgcccacgtacttggctacgtcggc
cgcatcaacgaaaaggaccaagcgctgctcgataccgatcccgatgttaagcgtcgctac
agtgcaactcagtacattggtaaaaccggtgttgaacgccgctacgaagaagatctgcat
ggcgaagtgggctatcaaaaagtcgaaaccaatgcacgggggcgtatcctcagtgttatc
gaacagcaagatccgattccaggtaaagacctaacactgcatcttgatgcccgtttgcaa
aagctagccgaaaaagaaatgactggccggcgtggtgccgttgttgcgatcgaagtggca
accggaggcatcgtcgcgctttatagcaacccggcattcgaccccaattccttcgtcacc
ggtatctctcacaaagactactctgatttgcgcgatgaccctgatcaaccgctatttgat
cgagcaacccgagggcaatacccaccagcctcgacactcaaacccttcatcggtttagcc
gcattaaatgcaggaacaacgaattggaacgatagcattcgcgaccaaggttggtacaaa
ctcgataatgatgaacgtttatatcgcgactggaaaagaggtggccacggacgagtcgat
cttgaaagagccgtagtggaatcatgtgatacctacttctatgacgtggcagtacgtact
ggaatcgatgggatcacaccctttcttgctcaatttggttttggccgcgatatgacccta
gacgttatttctgctctacctggcttactgccagatcgagattggaagaaagcccatcga
cgaggctcttggtatgctggcgacaccgttaacttaggtattggtcaaggcttcatgtta
acaacaccgttgcaactagcgactgccactgcggtactggcaaaccgcggaaaatggcaa
ataccacggctaatttatgcgcacaatgaagtcgaagacgtgatcgagcacggtgatatc
cccgatattcaattacgtaacccagataactggaatcgcatgtttaatgcgatggccaac
gttgtctctggacagcatggcactgcgcgacgcttgctcagcaatatgcaattcccgatg
gccgccaaaacagggacggcccaagtggtggggattaagcaagacgaagagtacgattcc
gaagcgttacgtgaacgtttacgcgatcatgcgctgtttattgcctttgctccggtagat
aatccgcagatcgccattgccgttattgtcgaaaacggcgaatccgctggtaaaacggcg
gggccaattgcgcaaagtattattaacgagtatctcggaggcgcggaaggctaa

DBGET integrated database retrieval system