KEGG   Thalassolituus oleivorans R6-15: R615_05515Help
Entry
R615_05515        CDS       T03056                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00061  Fatty acid biosynthesis
tor00780  Biotin metabolism
tor01100  Metabolic pathways
tor01212  Fatty acid metabolism
Module
tor_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    R615_05515
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    R615_05515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tor01004]
    R615_05515
Enzymes [BR:tor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     R615_05515
Lipid biosynthesis proteins [BR:tor01004]
 Fatty acid synthase
  Component type
   R615_05515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AHK15382
UniProt: W8G7Q0
LinkDB All DBs
Position
1188603..1189067
Genome map
AA seq 154 aa AA seqDB search
MSTHNIQKIQEVMPHRYPFLLLDRVVDVDLDAEGGAIIHAYKNVSINEDFFNGHFPGHPV
MPGVLTLEAMAQAAGFLGVMMQGDTRKPTTIFYFAGADHVRFKRPVVPGDQLKLEARLIG
KRSGIWKFDCQAMVDDEVVCIAELTCAEKDLEQK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcacaacattcagaaaattcaagaagtgatgccgcatcgctacccgtttcta
ctcttagatagagtagttgatgtcgatttagacgcagagggtggagctattattcacgct
tataaaaatgtcagcattaatgaagatttttttaatggccatttccccggccatccggta
atgcccggcgttttaaccttagaggcaatggcgcaagctgctggatttttaggcgtgatg
atgcaaggcgatacgcgtaaaccaacgactattttttattttgctggtgcagatcatgtg
cgtttcaaacgcccagttgtaccgggagatcagttaaaattagaagcacggctgattgga
aaacgcagtggtatttggaaatttgattgtcaggctatggtggatgacgaggttgtctgt
atcgccgaacttacctgcgctgaaaaagatttggagcaaaaatga

DBGET integrated database retrieval system