KEGG   Thalassolituus oleivorans R6-15: R615_10005Help
Entry
R615_10005        CDS       T03056                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00020  Citrate cycle (TCA cycle)
tor00190  Oxidative phosphorylation
tor00650  Butanoate metabolism
tor01100  Metabolic pathways
tor01110  Biosynthesis of secondary metabolites
tor01120  Microbial metabolism in diverse environments
tor01130  Biosynthesis of antibiotics
tor01200  Carbon metabolism
Module
tor_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tor_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R615_10005 (sdhB)
   00650 Butanoate metabolism
    R615_10005 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    R615_10005 (sdhB)
Enzymes [BR:tor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     R615_10005 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     R615_10005 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AHK16042
UniProt: W8G9L4
LinkDB All DBs
Position
complement(2123116..2123826)
Genome map
AA seq 236 aa AA seqDB search
MLVSIYRYNPEKDAAPFMQDYEIALPAGKDLMVLDVLNLVKEKDVSVSYRRSCREGVCGS
DGMNINGKNGLACITPISEATKGKMDKLVLRPLPGMPVIRDLVIDMSLFYKQYEKIKPYL
VNNTPAPAIERLQTPEEREKLDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYRFL
ADSRDTMTQERLAELSDPFSVFRCRGIMNCVNVCPKGLNPTRAIGHIRNMLLSQQL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgttagttagtatctatcgctacaaccctgaaaaggatgcagcgccgttcatgcaagac
tatgagattgctctccctgcgggaaaagatcttatggttctggatgttctgaacttagta
aaagagaaggacgtatcggtctcataccgccgttcttgccgtgagggcgtatgtggctcc
gatggcatgaacattaatggtaagaacggtttggcttgtattacgccaatctctgaagca
acaaaaggcaaaatggacaagctagtgctgcgtccattacctggtatgccagttattcgt
gacttggttatcgacatgtctttgttctacaagcagtacgaaaagatcaagccttacttg
gtgaacaatacaccagctccggctatcgaacgtctgcaaactccagaagagcgtgagaag
ttagacggtttgtacgagtgtattctgtgtgcatgctgctcaacctcttgcccatctttc
tggtggaacccagataagtttgttggtcctgctggcttgttgcaggcataccgtttctta
gcggatagccgtgacacgatgacacaagaacgattggcggaattgagcgatccattcagt
gttttccgttgccgtggcattatgaactgtgtcaatgtgtgccctaagggtttgaaccca
actcgcgccattggtcacattcgtaatatgttgctttctcagcagctgtaa

DBGET integrated database retrieval system