KEGG   Thalassolituus oleivorans R6-15: R615_10010Help
Entry
R615_10010        CDS       T03056                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00020  Citrate cycle (TCA cycle)
tor00190  Oxidative phosphorylation
tor00650  Butanoate metabolism
tor01100  Metabolic pathways
tor01110  Biosynthesis of secondary metabolites
tor01120  Microbial metabolism in diverse environments
tor01130  Biosynthesis of antibiotics
tor01200  Carbon metabolism
Module
tor_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tor_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tor_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R615_10010 (sdhA)
   00650 Butanoate metabolism
    R615_10010 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    R615_10010 (sdhA)
Enzymes [BR:tor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     R615_10010 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     R615_10010 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 Thi4 Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AHK16043
UniProt: W8G5G9
LinkDB All DBs
Position
complement(2123842..2125614)
Genome map
AA seq 590 aa AA seqDB search
MTKIRTMSFDAIVIGGGGAGMRAALQLTEAGIKTACVTKVFPTRSHTVSAQGGITCAIAS
NDPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPQAVFELEHMGLPFSRTEEGRIYQRP
FGGQSKGPNDPTQAARTCAAADRTGHALLHALYQGNLKGGTTFLNEWYAVDLVKNSKGQV
AGVIAIDIESGETSYIKAKATVLATGGAGRIYQSTTNALINTGDGVGMALRAGVPMQDME
MWQFHPTGIAGAGTLVTEGCRGEGGYLINKDGERFMERYAPNAKDLAGRDVVARSMVLEI
LEGRGCGEDGDHVFLKLDHLGEETLNAKLPGILELSRTFAHVDPVKEPIPVVPTCHYMMG
GVPTNIGGQALTVDAEGNDVVVEGLYAAGEIACVSVHGANRLGGNSLLDLVVFGRAVGLR
VEQSFKDGFETSDVSDEDIERAMARLNRLNTSTTGEKVATVRADLQKTMQLYFGVFRDGP
SMEKGLKMLDEIGERVKKTVLEDKSQAFNTARIEALELDNLFETAYATAVAAVERKESRG
AHARNDFTERDDENWLCHSLYIPQTKTIGKRAVNFAPKTMEAFQPKIRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatcagaacaatgtcttttgacgctatcgttatcggtggcggcggtgcgggt
atgcgtgcagcacttcagttgactgaagctggcatcaaaaccgcgtgtgtgactaaagtt
ttcccaactcgctcacacactgtgtcggcgcagggtggtattacttgtgctatcgcttcc
aatgatccgaatgatgattggcgctggcacatgtacgacacggttaaaggttccgattac
atcggtgaccaagacgctattgaatatatgtgttcagtaggtccacaagccgtgttcgaa
ctagagcatatgggcttgccgttttctcgtactgaagaaggtcgtatttatcagcgtcct
ttcggcggtcaatctaagggtccaaacgatcctactcaggcagctcgtacttgtgctgct
gctgaccgtacaggtcacgcactattacacgccctgtatcagggtaacttgaaaggcggt
actacattcttaaacgaatggtatgccgttgatctagtgaaaaactctaaaggtcaggtt
gctggtgttatcgcgattgacatcgaatctggtgaaacgagctacatcaaagctaaggca
actgttttagcgacaggtggtgctggtcgtatttatcagtctacgacaaacgcattgatc
aacaccggtgacggcgttggtatggcgttgcgtgctggtgtaccaatgcaagatatggaa
atgtggcagttccacccaacgggtattgctggcgcaggtacattggtaactgaaggttgt
cgtggtgaaggtggttacctgatcaacaaagacggcgaacgtttcatggagcgttatgct
ccaaacgcgaaagaccttgctggtcgtgacgttgttgctcgctctatggttctagaaatt
ctagaaggccgtggttgtggggaagacggcgatcacgtgttcctgaaactggatcatctt
ggcgaagaaactcttaatgctaagttgcctggtattcttgagctatctcgtacgtttgcg
cacgtagatcctgtgaaagaaccaatccctgttgttcctacctgtcactacatgatgggc
ggtgtgccgactaacatcggtggtcaagcgctgactgttgatgctgagggcaatgacgtt
gtggttgagggcttatacgctgctggcgaaatcgcttgtgtatcggttcacggtgcaaac
cgtttgggtggtaactcattgcttgatttggtcgtgttcggtcgtgccgttggtttacgc
gttgaacaaagctttaaagatggttttgagacatctgacgtatctgacgaagatatcgaa
cgcgcaatggctcgtttgaatcgtctgaatacttcgacgactggcgagaaagtggcgaca
gtgcgtgcggatcttcaaaagactatgcaattgtacttcggcgtattccgcgacggtcca
agcatggaaaaaggtttgaaaatgctggatgaaatcggtgagcgcgttaagaaaactgtg
cttgaagataagagccaagcgtttaacaccgcccgtatcgaagcacttgagttggataat
ctgttcgaaacagcttatgcaactgcggtagcagcggttgagcgtaaagagtctcgcgga
gcgcatgctcgtaatgactttactgagcgcgatgacgagaactggttatgccattctttg
tatattcctcagactaagaccatcggcaagcgcgcggtgaactttgctcccaaaaccatg
gaagcgttccaaccgaaaatccgtacctattaa

DBGET integrated database retrieval system