KEGG   Thalassolituus oleivorans R6-15: R615_11440
Entry
R615_11440        CDS       T03056                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
tor  Thalassolituus oleivorans R6-15
Brite
KEGG Orthology (KO) [BR:tor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tor03009]
    R615_11440 (rlmL)
Enzymes [BR:tor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     R615_11440 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     R615_11440 (rlmL)
Ribosome biogenesis [BR:tor03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    R615_11440 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_31 Methyltransf_25 Methyltransf_15 Methyltransf_11 Methyltransf_24
Other DBs
NCBI-ProteinID: AHK16256
UniProt: W8FXV3
LinkDB
Position
complement(2443359..2445500)
AA seq 713 aa
MQNETNATQHTFLAACPKGIESLLADEIRELGGEVERETILGVVWRGDLATAYRFCLWSR
LASRLLLPLQESQVDNVDEMYEAARSVDWPMVFPVGATFRIDFHGRTDYLNNTQFGAQKI
KDAIVDCFREEEGARPTVDKDGDIRIEAQLRKGKIFLYLNLTGDSLHRRGYRLQPGKAPL
KENLAAAILIRAGWPALAKAGKHLIDPMCGSGTILIEAGQMAADVAPGLNRQRWGFDRWH
QHDRKTWLAEVEAARIRRTEGLAAMTSRLYGFDIDGDQLNAATKNLERSGLAGKVHLERR
SIEQLRVQKEVIAEGGIVVCNPPYGERLSELPQLAPLYQQFHDATMQMPEWPIAMFTANL
DLARSVRRPVNKQYKLMNGKIETRLLVFGAADERSDRAPASAIRGPVEAFANRLKKNIKN
LQKWANRENVHCYRLYDADLPEYAVAVDRYEDWLHVQEYVPPKTIDPTVAERRLLDVLAV
LPEVTGVPAEQIVLKRRERQTGRKQYEKYNDEKSTMVVREGQVQLQVNLKDYLDTGLFLD
HRPTRIEIAQLAKGKRFLNLFCYTATASVHAAAVGAHCTSVDMSRTYLNWGRENFRLNKI
NDELHKFIQADCLHWLREDKGSYDIIFMDPPTFSNSKRMEGVLDIQRDHVDLIRLAMARL
APGGTMIFSNNLRKFDMDAEALSEFTIVDVSAKSIPTDYARRTNIHVCYHITK
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgcaaaacgaaacgaacgccactcaacacacttttttggcagcttgcccgaagggaatt
gagtcactattggccgatgaaatcagagagttaggcggtgaagttgagcgcgaaactatt
ctcggtgtggtttggcgtggcgacttggcgaccgcttatcgattttgtttatggtcgcgc
cttgccagtcgtttgttgttaccactgcaagaaagtcaggtagacaatgtcgacgaaatg
tatgaggcggcccgttcggtcgactggccgatggtattccccgtgggcgctacgttccgt
atcgattttcacggtcgtaccgactacctaaataacacccaatttggtgcgcaaaaaatc
aaagatgcgatcgtcgattgttttcgcgaggaggagggggctcgccctacggtagataaa
gatggcgatattcgtattgaggctcagctacgtaaaggtaagattttcctctatctaaat
ttgaccggtgatagcttgcatcgtcgtggctatcgtttgcagccaggcaaggctccgttg
aaagaaaacttagccgctgcgattcttattcgtgccggttggccagcattggctaaagct
ggaaaacacctgattgaccctatgtgtggttcgggaacaattttgatcgaagctggccag
atggctgcagatgtcgcaccgggtcttaaccgtcagcgttggggcttcgatcgttggcac
caacacgatcgaaaaacatggttagcagaagttgaagcggcacgaattcgtcgtaccgaa
ggtttagccgccatgacgagtcgtttatatggctttgatattgatggtgaccaacttaac
gctgcaacaaagaacctcgaacgctcaggtcttgccggtaaagtgcatttggaacgccgt
agcattgaacagctgcgtgtgcagaaagaggtgattgcggagggcggtattgttgtttgt
aacccaccttacggtgaacgtttaagtgaattgccgcaattagcgccgctgtatcagcaa
tttcacgatgccaccatgcaaatgccggaatggccgattgccatgtttaccgccaaccta
gatttagcgcgcagtgttcgccgcccggtgaataagcaatacaagttaatgaacggcaaa
attgaaacccgtttgctggtatttggtgctgccgatgaacgctctgaccgtgcgcctgcc
agtgcgattcgtgggccggtagaagccttcgctaaccgtttgaaaaagaacatcaagaat
ctacaaaagtgggcaaaccgcgaaaacgtgcattgctatcgtttatacgatgccgatttg
ccggagtacgcagtggccgttgatcgctacgaagattggctgcacgtacaagaatacgta
ccccctaaaacgattgatcctacggtggctgaacgtcgtttactcgatgtactagctgta
ttgccagaagtcaccggcgtaccggctgagcaaatcgtacttaaacgtcgcgagcgccaa
acgggtcgcaagcaatatgaaaagtacaacgatgaaaaaagcacgatggtcgtgcgtgaa
ggccaagtgcaattacaagtaaacctaaaagattatttagatactggcttgtttttggat
caccgcccaacacgtatagaaattgctcagcttgccaaaggcaaacgctttttaaacctg
ttttgctacaccgcgaccgccagtgttcatgccgccgccgtgggcgcacattgtaccagc
gtggatatgtcgcgtacctatttaaactggggtcgtgaaaacttccgtttaaataaaata
aacgacgaactgcacaagtttatccaagccgattgtttgcattggttgcgtgaagataaa
ggcagctatgacattatctttatggacccgccaaccttctctaactctaagcgtatggaa
ggcgtgctggatattcagcgtgatcatgtcgatttgattcgtcttgcaatggcacggcta
gcgccgggcggtacgatgattttctcgaacaacctgcgtaagttcgatatggatgcagaa
gcactgagcgaatttacgattgtggatgtgagcgccaaatccattcctaccgactatgcg
cgtcgcaccaatattcatgtgtgttatcacatcaccaagtga

DBGET integrated database retrieval system