KEGG   Thalassolituus oleivorans R6-15: R615_12720Help
Entry
R615_12720        CDS       T03056                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tor  Thalassolituus oleivorans R6-15
Pathway
tor00620  Pyruvate metabolism
tor00680  Methane metabolism
tor01100  Metabolic pathways
tor01120  Microbial metabolism in diverse environments
tor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R615_12720
  09102 Energy metabolism
   00680 Methane metabolism
    R615_12720
Enzymes [BR:tor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     R615_12720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHK16441
UniProt: W8FYF0
LinkDB All DBs
Position
complement(2723437..2726070)
Genome map
AA seq 877 aa AA seqDB search
MEELDALLRDKVRVLGSQLGGTIERQLGDGMLEQIERIRKQAKLARHGDPKERETLLAML
HDISDDELGPVVRGFNQFLNLANIAEQQHGISWRRSEHLQENVDSMFSELLTRLESSGIR
GIDLSQQVADVNIELVLTAHPTEITRRTLIQKYDHIAQLLQRRDDLRDGHPDLANIEQEI
SLIIDEIWHTDEIRQVRPTAVDEAKWGFAVIENSLWYAIPALLRDLDQELRARGSSALPL
TAVPIRFSSWMGGDRDGNPNVTATVTREVLYLARWMAADLFLRDIELLGMQLSMSEASAD
MRQQYTGREPYRDCLHDLRKGLEDTRRWADACAAGESTKKVPILEREDVIRPLKLCYDSL
VDCGMDTIANGMLLDTIRRAACFGMSLVRLDVRQESTRHSDVLQAICEYYGWGDYNGWTE
DEKQTFLLRELTSRRPLIPNFWTPSAEVQEVLDTMAVLATPAGDGVSCYIISMASEPSDI
LAVALLLQACGVKRLLPIVPLFETLSDLEQSGPRMDKLWSLPWYREYSMCRQQVMIGYSD
SSKDAGQLAAVWAQYQAQETLSRVAAEQGIKLRLFHGRGGTVGRGGGPAQRAILAQPPGS
VTGGLRVTEQGEMIRFKFGLPAVAQRNLKVYVSAVLEANLLPPAHPKDEWREMMSQLAAA
GVSSYRAMVKDNPDFVRYFRAATPESELGKLSLGSRPARRRSGGGIETLRAIPWIFAWTQ
MRLMLPAWLGADDALRVQVDNEQLPRLKEMYSDWPFFRTYIDMLEMVLSKADPAIAQYYE
ERLVEPELQPIGSVLRERLANMRKLVLAVKEQTMLLENNKALQYSMQVRDPYTDPLHYLQ
AELLYRERQAADMVSSQVERALMVTMAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactggacgcattgctgcgcgacaaggtccgagtgctgggtagccagcttgga
ggtactattgaacgacagctaggcgatggcatgcttgagcaaattgagcgtattcgtaaa
caagcaaagcttgctcgccatggcgatccgaaagaacgcgaaacacttctcgccatgctg
catgatatttctgatgatgagcttgggcctgttgtacgcggctttaatcagtttttaaac
ttggccaatattgccgagcagcagcacggaatcagttggcgtcgcagtgaacatctgcaa
gaaaatgtcgatagcatgtttagcgagttacttactcgtttagaatcttcgggcattcgt
ggtatcgatttaagccagcaagttgccgacgttaatattgaattggtattaaccgcgcac
ccaacggaaattacccgccgtacacttattcaaaaatatgatcacatagcgcagttattg
cagcgtcgcgatgatttacgcgatggccatcctgatttagccaatatagaacaagaaata
tcactaattattgatgagatttggcataccgatgaaattcgccaagtacgcccaacggca
gtcgatgaagcgaaatggggttttgccgttattgaaaactctttgtggtacgccattcca
gccttgctacgagatttagatcaagaattacgcgcacgtggtagtagcgctttaccatta
accgccgtacctattcgtttttcgtcatggatgggcggtgatcgcgacggtaatccgaat
gtgaccgcgaccgtgacacgtgaagtgctatacctcgcccgctggatggccgcggatttg
tttttacgggatatagaactgttaggcatgcagttatctatgagcgaagcatcagcagat
atgcgtcagcaatatacaggtcgagaaccttaccgtgattgcttacacgatttacgcaaa
gggctagaagatactcgtcgctgggctgatgcttgcgccgctggagaaagcactaagaaa
gtcccaatactcgaacgcgaagatgtgattcggccattaaagttgtgctatgacagtttg
gttgattgcggtatggataccatcgccaatggcatgttgttagataccattcgtcgtgca
gcatgttttggtatgtcgttggttagactcgatgtcagacaagagtcgactcgtcacagc
gatgtgcttcaagctatttgtgaatattatggttggggtgattacaacggctggacagaa
gacgaaaagcaaacgtttttgctgcgtgagttaacttcacggcgcccattaatccccaac
ttctggacaccttcagcagaggtgcaagaagtattggataccatggcggtgttagcaacg
cctgctggtgatggcgtatcttgctacattatttcgatggccagcgagccttccgatatt
ttagcggtagcacttttgttgcaagcctgtggcgttaaacgtttattaccgattgtgcct
ttattcgaaactttgtcggacttagagcagtcaggtccgcgtatggataaattatggtcc
ttaccttggtatcgcgaatacagcatgtgtcgccagcaagtgatgataggttattctgac
tcgtctaaagatgccggccaattggcggctgtttgggcgcagtatcaggcgcaagaaact
ttgtcgcgcgtggcagccgagcaaggtattaaattacgtttatttcatggccgtggcggt
accgttggacgcggaggtggccctgcgcaacgcgctattttggcgcaaccaccgggttca
gtaacgggcggattacgcgtgaccgagcagggcgaaatgatccgctttaaatttggtttg
ccagcggttgctcagcgtaatcttaaagtttatgtgtcagctgtattagaggctaactta
ttaccgccagcccatccaaaagacgaatggcgagagatgatgtcgcaattagcggctgca
ggcgtttcttcttatcgcgcaatggttaaagacaatcctgattttgtgcgttatttccgt
gcggcaacgccagagtcggaattaggaaaattatctttgggcagtcgtcctgcgcgccgt
cgttctggtggcggtattgaaacattacgcgctattccttggatttttgcttggacgcaa
atgcgcttaatgttgcctgcttggttaggtgctgacgatgcgcttcgagttcaggtcgat
aacgagcaattaccgcgacttaaagaaatgtatagtgactggccatttttccggacttac
atcgacatgctagagatggtgttgtcgaaagccgacccggcaattgcacagtattatgaa
gaacgtttggttgagccagagctacagccaatcggtagcgttttacgtgagcgtctggcg
aatatgcgcaagctagtgttggcagtaaaagagcaaacaatgttgttggaaaataataaa
gcgctgcaatattctatgcaggtacgcgatccttataccgatccgttgcactatttacag
gccgagcttttgtatcgtgaacgtcaggctgccgatatggttagcagccaagttgaacgt
gctttaatggtgacgatggcgggtatcgctgctgggatgcgtaataccggatag

DBGET integrated database retrieval system