KEGG   Thalassolituus oleivorans R6-15: R615_14345Help
Entry
R615_14345        CDS       T03056                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tor  Thalassolituus oleivorans R6-15
Brite
Enzymes [BR:tor01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     R615_14345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AHK16665
UniProt: W8FZP9
LinkDB All DBs
Position
3095400..3095981
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYEKTALEPHISAETLDFHHGKHHNTYVQKLNGLIGGTEFEGKTLEEIIKTS
SGGVFNNAAQIWNHTFYWNSLSPNGGGEPTGAIADAITAAFGSFADFQAKFNDSAVNNFG
SSWTWLVKKADGSLDIVNTSNAATPITEEGVTPLLTVDLWEHAYYIDYRNVRPDYLKGFW
ALVNWDFANANFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgaacttcctgctctaccgtacgaaaaaactgctctagaacctcatatttct
gcagaaacattagattttcaccacggtaagcatcacaacacttacgttcaaaagttgaac
ggcttaatcggtggtactgaattcgaaggtaaaaccctagaagaaatcatcaagacttca
tctggtggtgttttcaataacgctgctcagatctggaaccacactttctactggaatagc
ctaagccctaacggcggtggcgagcctactggcgcaattgccgacgcaattaccgctgcg
ttcggatcttttgctgatttccaagctaaattcaacgacagcgcagtgaacaactttggt
tcaagctggacttggttagttaagaaagcagatggttctttagacatcgtaaacacgtca
aacgctgcaaccccaatcaccgaagaaggtgttacaccgttgttgacagttgatttgtgg
gaacacgcttactacatcgattaccgcaacgtgcgtcctgattacctgaaaggtttctgg
gcactggttaactgggacttcgcgaacgctaacttcgcttaa

DBGET integrated database retrieval system