KEGG   Thermus oshimai: Theos_0764Help
Entry
Theos_0764        CDS       T02346                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tos  Thermus oshimai
Pathway
tos00020  Citrate cycle (TCA cycle)
tos00270  Cysteine and methionine metabolism
tos00620  Pyruvate metabolism
tos00630  Glyoxylate and dicarboxylate metabolism
tos00680  Methane metabolism
tos00710  Carbon fixation in photosynthetic organisms
tos01100  Metabolic pathways
tos01110  Biosynthesis of secondary metabolites
tos01120  Microbial metabolism in diverse environments
tos01130  Biosynthesis of antibiotics
tos01200  Carbon metabolism
Module
tos_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tos_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tos_M00012  Glyoxylate cycle
tos_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theos_0764
   00620 Pyruvate metabolism
    Theos_0764
   00630 Glyoxylate and dicarboxylate metabolism
    Theos_0764
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Theos_0764
   00680 Methane metabolism
    Theos_0764
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Theos_0764
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Theos_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4885 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AFV75824
UniProt: K7R4L0
LinkDB All DBs
Position
complement(703753..704736)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPIVLQLLEIPQAMKALEGVIMELEDC
AFPLLAGIEASDDPKVAFRDADYALLVGAAPRKAGMERRDLLEMNGRIFTEQGRALAEVA
KREVKVLVVGNPANTNALIAYKNAEGLDPRNFTAMTRLDHNRAKAQLSKKTGVPVDRIRK
LAVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDFVSMAVPSRGEYGIPEDIVYSFPVTAKDGVYTVVEGLEIT
PFARERMEITARELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcccgtacgcgtagcggtgaccggtgccgcaggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccaacccatcgtcctccagctt
ctggaaatcccccaggccatgaaggccctggaaggggtcatcatggagctggaggactgc
gccttccccctcctcgcggggatagaggccagcgacgaccccaaggtggcctttagggat
gcggactacgcccttttggtgggggccgcccccaggaaggcggggatggaacggcgggac
ctcctggagatgaacggccgcatcttcaccgagcagggccgggccctggcggaggtggcc
aagcgggaggtgaaggtgctggtggtgggcaaccccgccaacaccaacgccctaatcgcc
tacaagaacgcggaagggctggacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccaactctccaagaagaccggggtcccggtggaccgcatccggaag
cttgcggtctgggggaaccactcctccaccatgttccccgacctcttccacgcggaggtg
gacgggaggcccgccttagagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggcctccagcgcggccagc
gccgccaacgccgccatcgagcacatccgggactgggccctagggaccccggagggggac
ttcgtctccatggccgtgccctcgaggggggagtacggcatccccgaggacatcgtctac
tccttccccgtcaccgccaaggacggggtgtacacggtggtggagggcctggagatcacc
cccttcgcccgggaaaggatggagatcaccgcccgggagcttctggacgagatggagcag
gtgaaggccctgggcctcatctaa

DBGET integrated database retrieval system