KEGG   Thermus oshimai: Theos_0838Help
Entry
Theos_0838        CDS       T02346                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tos  Thermus oshimai
Pathway
tos00564  Glycerophospholipid metabolism
tos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Theos_0838
Enzymes [BR:tos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Theos_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFV75895
UniProt: K7QYV2
LinkDB All DBs
Position
784410..785930
Genome map
AA seq 506 aa AA seqDB search
MPFEREALWERLKEPLDLLVVGGGATGAGLLWAATLRGLRAALVERGDFASGTSSRSTKL
LHGGVRYLELAFRRLDRRQFRLVVDALHERQVVLGLAPHLARPLTLLTPLFRPLEIPYYW
TGLQLYDLLAGKRRLGGSGYIPPKEVARLFPDLPSTLGGVLYRDGQFEDFRLNLALVRSA
LQRGAIALNYAEATGFLLKGDHVRGAVVRDRLTGREREVEARAVVNAAGPLADGVRRLLD
LHLPPLLTPSSGAHLVLDYSLTVGLLLPRTRDGRVLFLLPWRGKALLGTTDLPASPEACP
RPRAEEEAYLLEEIRPLLGDLSGRVLARWAGLRPLVGKGETRLLVRDHLILEERGLYTLV
GGKWTTFRLMAEDLLERLRRDLGLLMGPPASAHTPLVGAGPRGEIPEALYQNYGLEAEGV
LALGERPLLPGLPHVEGEVLWAVREELAVKPLDVLARRMGLALLDQKAALEALPRVVALM
APVLGWDEGRAKREEEEARAGLPGLC
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgagcgcgaggccctttgggaacggctaaaggagcccctggacctcctcgtc
gtgggcgggggggccacgggggcggggcttctctgggcggccaccttaagggggcttcgg
gccgccctggtggagcggggggacttcgcctcggggacgagctcccggagcaccaagctc
ctccacgggggggtgaggtacctggagctcgccttcaggaggctggaccggcgccagttc
cggctggtggtggacgccctccacgagcgccaggtggtcttgggcctggccccccacctg
gcccggcccctcaccctcctcacccccctcttccgccccctggagatcccctactactgg
acgggcctccagctctacgacctcctggcggggaaaaggcgccttggggggagcggctac
atcccccccaaggaggtggcccgcctcttcccggaccttccctccaccttgggcggggtc
ctctaccgggacgggcagtttgaggacttccgcctgaacctggccctggtgcgctcggcc
ctccagcggggggccatcgccctcaactacgccgaggccacggggtttctcctgaagggg
gaccacgtgcggggggcggtggtgcgggaccggctcacggggcgggagcgggaggtggag
gcgagggcggtggtgaacgccgcggggcccctggcggacggggtgcgccgcctcctggac
ctccatcttccccccctcctcaccccctccagcggggcccacctggtcctggactattcc
ctcaccgtgggccttctcctccccaggacccgggacggccgggtcctcttcctcctcccc
tggcgggggaaggccctcctcggcaccaccgacctccccgcctcccccgaggcctgcccg
aggccccgggcggaggaggaggcctacctcctggaggagatccggcccctccttggggac
ctctcggggcgggtcctggcgcggtgggcggggcttaggcccctggtggggaagggagaa
acccggcttttggtgcgggaccacctcatcctggaggagcgaggcctttacaccctggtg
ggggggaagtggaccaccttccgcctcatggcggaagaccttctggagaggctccggcgg
gacctgggcctcctcatggggcctcccgcttccgcccacacccccttggtgggggcgggg
cctaggggggagatccccgaggccctttaccagaactacggcctggaggcggaaggggtg
ttggccctgggggaaaggcccctccttcctggcctcccccacgtggagggggaggtcctt
tgggcggtaagggaggagcttgcggtgaagcccctggacgtcctcgcccgaaggatgggc
ctggcccttttagaccagaaggcggcgctagaggccctcccccgggtggtggccctcatg
gcccccgttttggggtgggacgaagggcgggccaagagggaagaggaggaggccagggcg
gggcttcctgggctttgctaa

DBGET integrated database retrieval system