KEGG   Thermus oshimai: Theos_0883Help
Entry
Theos_0883        CDS       T02346                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tos  Thermus oshimai
Pathway
tos00620  Pyruvate metabolism
tos00680  Methane metabolism
tos00710  Carbon fixation in photosynthetic organisms
tos01100  Metabolic pathways
tos01120  Microbial metabolism in diverse environments
tos01200  Carbon metabolism
Module
tos_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Theos_0883
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Theos_0883
   00680 Methane metabolism
    Theos_0883
Enzymes [BR:tos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Theos_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFV75939
UniProt: K7R4S3
LinkDB All DBs
Position
837081..839657
Genome map
AA seq 858 aa AA seqDB search
MREDPFSLLKEEVDLLGRLLGEAIGRVSGERFFALVEEVRLLSKARRQGDEGAGEALLAK
AGALSVAEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAEAETPEAPRPEGPLALAQALK
ARGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHHLERIQEVLERGDREELKARVALL
YATEEVRKARPSVEDEIKGGLYYLPTTLWKAVPLLLERLEAAFERVYGKRPRLKSPVRFR
SWIGGDRDGNPFVTPEVTAFAAAYARRVAKERYLAELEALVRDLSLSEARLPAPRAVREG
GEGVERFPGEPYRRYFAALYGKLEGEALSEEDFARALLQAERGLEEAGLGEVARVFLRPL
SARLSAFGLALAPLDLREESGKLLEAAAELLRLGGVHPDFLGLPEEAQEALLTEELKTPR
PLLPVGQAPEGEALRVALGALRAWRDRGAHVVSMAHGPRDVLAVFLLAREVGDYRPGKPL
PYDVAPLFETLEDLRRAPQVLRRLLQNPVFLAHARGRGGVEVMIGYSDSNKDAGFLAANL
ALYQAQEALAAVGREAGLRVHFFHGRGTSTARGGGPAGRAIASLPPRSVGHRLRLTEQGE
ALADRYGHVELAVRHLEQLLYHFALAALAEGGDPRPSWLEALEEAAALSVERYRALLQAE
GFFPFFEHLTPIREIGELPIASRPVYRHGRVRDIRDLRAIPWVMAWTQVRLLLPGWYGLS
ALEGLPLSLLQEMYRGWPFFATTLESAAMALAKADLGVARLYLRLVPEPLRPLFDRIAEE
YRKTVALLEAVFQAPLLHNQKTLERQIALRNPYVDPINLLQVELLRRYRAPGGAEDEALK
KALLLSILGVAAGLRNAG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgagggaagaccccttttccctcctaaaggaggaggtggacctcctgggccgcctcctg
ggggaggccatcgggagggtctcgggggagcggttttttgccctggtggaggaggtgcgc
ctcctctccaaggcccgccgccagggggacgagggggcgggggaggcccttttggccaag
gcgggggccctttccgtggccgaggcggaggccttggtgcgggccttcacccactacttc
cacctggtgaacctggccgaggagcgccaccgggtgcgggtgaaccgcctccgggcggag
gcggaaaccccggaggccccaaggcccgaggggcctttggccttagcccaggccctgaag
gcccgggggctttccctggaggaggcggaggcccacctaaaccgcctggagctcctcctc
accttcaccgcccaccccacggagacccgccgccgcaccctgaggcaccacctggagagg
atccaggaggtcctggaaaggggggatagggaggagctcaaggcccgggtggccctcctc
tacgccacggaggaggtgcgcaaggcccggccctcggtggaggacgagatcaaggggggg
ctttactacctgcccaccaccctctggaaggcggtgcccctcctcctagagcgcctcgag
gccgcctttgagcgggtctacgggaaaaggccccgcctgaaaagccccgtgcgcttccgg
agctggatcgggggggaccgggacgggaaccccttcgtgacccccgaggtcacggccttc
gccgcggcctacgcccggcgggtggccaaggagcgctacctggcggagctcgaggccctg
gtgcgggacctctccctctccgaggcccgccttcccgcgccccgggcggtgcgggaaggg
ggggagggggtggagcgctttcccggggagccctaccggcgctacttcgccgccctgtac
ggcaagcttgagggggaggccctttccgaagaggactttgcccgggccctcctccaggcg
gaacggggcctggaggaggcgggcctgggggaggtggcccgggtcttccttaggcccctt
tccgcccgcctctccgccttcggcctggccctggcccccctggaccttagggaggagtcg
gggaagctcttggaggccgcggccgagctcctccggcttgggggggtgcacccggacttc
ctgggccttcccgaggaggcccaggaggccctcctcacggaggagctcaagaccccgcgc
cccctcctccccgtgggccaggccccggagggggaggccttaagggtggccctcggggcc
ctaagggcctggcgggaccggggggcccacgtggtctccatggcccacgggcctagggat
gtcctcgcggtcttcctcctcgcccgggaggtgggggactaccgcccaggaaaacccctc
ccctacgacgtggcgcccctttttgaaaccctggaggacctaaggcgggccccccaggtc
ctccgccgcctcctccagaaccccgtcttcctggcccacgcccgggggcggggcggggtg
gaggtgatgatcggctactccgactccaacaaggacgcgggcttcctggcggccaacctg
gccctctaccaggcccaggaggccctggcggcggtggggcgggaggcggggcttagggtc
cacttcttccacggccggggcacctccaccgcccggggcgggggccccgcgggccgggcc
atcgcctccctgcccccaaggagcgtgggccaccgcctccgcctcacggagcagggggag
gccctggcggaccgctacgggcatgtggagctggccgtgcgccacctggagcagctcctc
taccacttcgccctggccgctttggcggaggggggagaccctaggccctcctggctcgag
gccctggaggaggccgccgccttaagcgtggagcgctaccgggccctccttcaggccgag
ggctttttccccttcttcgagcacctcacccccatccgggagatcggggaactccccatc
gccagccgccccgtctaccgccacggccgggtgcgggacatccgcgacctccgggccatc
ccctgggtcatggcctggacccaggtgcggctcctcctccccggctggtacgggctttcc
gccttggaaggcctgcccctttccctcctccaggagatgtaccggggctggcccttcttc
gccaccaccctggagagcgcggccatggccctggccaaggcggacctgggggtggcccgg
ctctacctaaggctcgtccccgagcccctccggcccctgtttgaccggatcgccgaggag
taccggaagacggtggcccttttggaggccgtcttccaggccccccttctccacaaccag
aagaccctggagcgccagatcgccctacggaacccctacgtggaccccatcaacctcctg
caggtggagctcctccgccgctaccgcgcccccgggggcgcggaggacgaggccctgaaa
aaggcccttctcctctccatcctgggggtggcggcgggcctgaggaacgcggggtaa

DBGET integrated database retrieval system