KEGG   Theileria orientalis: TOT_010000196Help
Entry
TOT_010000196     CDS       T03460                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tot  Theileria orientalis
Pathway
tot00020  Citrate cycle (TCA cycle)
tot00190  Oxidative phosphorylation
tot01100  Metabolic pathways
tot01110  Biosynthesis of secondary metabolites
tot01130  Biosynthesis of antibiotics
tot01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TOT_010000196
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TOT_010000196
Enzymes [BR:tot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TOT_010000196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 TAT_ubiq
Motif
Other DBs
NCBI-GeneID: 20713146
NCBI-ProteinID: XP_009689029
UniProt: J7M8D2
LinkDB All DBs
Position
1:complement(join(420131..420192,420228..420414,420456..420635,420678..420920,420959..421147))
Genome map
AA seq 286 aa AA seqDB search
MASSRVGIVFKSAINRAPKNVEFSVFRYTPNSKQKPTMKSYTVDTNDCGPMILDALIKIK
NEMDSTLTFRRSCREGICGSCAMNVNGENGLVCLMDIEKHTAKGKIEVQPLPGMYVLRDL
VPDLTNFYEQYRSVEPWLKRKSPKEGEKEYHQSREDRQKLDGLYEVSGACDSDVQCILCA
CCSTSCPSYWWNPEHYLGPAALMQAYRWVADSRDEYTTERLVGVNDTMKLYRCHGIMNCT
KVCPKGLDPAGAIEKLKRHIAENVSEDWEQVALDEYKQRTRNALNL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaagcagagtaggaatagtgttcaaatcggcaataaacagagctccgaaaaac
gtggagttctcagtcttcagatatacgccgaactcgaagcagaagccgacgatgaagtcg
tacacggtggatacgaacgactgcggaccaatgatactggacgcactgataaagataaag
aacgaaatggatagcacgctgaccttccgaagaagctgcagagaagggatttgcggaagc
tgcgcaatgaacgtaaacggagaaaacggactggtgtgcctaatggacatagaaaagcac
acggccaaggggaaaattgaggtgcagccgctgccgggaatgtacgtgctgagggacctc
gtgccggacctgaccaacttctacgagcagtacagaagcgtggagccgtggctgaagagg
aaatcgcctaaggagggagagaaggagtaccaccagtcgagggaggacaggcagaagctg
gacggactctacgaggtaagcggagcttgtgacagcgatgtgcagtgtatactgtgcgcg
tgctgctcgacgtcgtgcccgtcgtactggtggaacccggagcactacctgggccccgcg
gcgctgatgcaggcctacaggtgggtggccgacagcagggacgagtacacgactgagcgc
ctcgtgggcgtgaacgacacgatgaagctgtacaggtgccacgggatcatgaactgcacg
aaggtgtgtccgaagggcctcgacccggcgggcgcaatagagaagctgaagaggcacata
gcggaaaacgtttctgaagactgggaacaagtggctctggacgaatacaaacagagaacg
agaaacgctctcaacttgtaa

DBGET integrated database retrieval system