KEGG   Theileria orientalis: TOT_010000846Help
Entry
TOT_010000846     CDS       T03460                                 

Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
tot  Theileria orientalis
Pathway
tot03030  DNA replication
tot03410  Base excision repair
tot03420  Nucleotide excision repair
tot03430  Mismatch repair
tot03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tot00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    TOT_010000846
   03410 Base excision repair
    TOT_010000846
   03420 Nucleotide excision repair
    TOT_010000846
   03430 Mismatch repair
    TOT_010000846
   03440 Homologous recombination
    TOT_010000846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tot03032]
    TOT_010000846
   03400 DNA repair and recombination proteins [BR:tot03400]
    TOT_010000846
Enzymes [BR:tot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     TOT_010000846
DNA replication proteins [BR:tot03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    TOT_010000846
DNA repair and recombination proteins [BR:tot03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      TOT_010000846
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     TOT_010000846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Motif
Other DBs
NCBI-GeneID: 20713713
NCBI-ProteinID: XP_009689691
UniProt: J4D675
LinkDB All DBs
Position
1:join(2038066..2038180,2038259..2038491,2038524..2038598,2038670..2039120,2039205..2039417,2039501..2039815,2039847..2039994,2040098..2040173,2040215..2040409,2040467..2040523,2040649..2040810,2040864..2040944,2041052..2041283,2041430..2041485,2041587..2041821,2041870..2041932,2042003..2042149,2042319..2042470,2042505..2042578,2042745..2042883)
Genome map
AA seq 1072 aa AA seqDB search
MIEIEPENTSFGQYSNFYGTKNDYGTLFRSLKRPDVDYIFFLTDADYTFKNVKYDANGGS
ERSDQGTEVPIIRLYGVTKQEQSVLVSLQNFNPYFYIEKPAALLDRHFDDLKELFTRHLS
EQNQFKRSLRYVLDIQKVRLTSLMLYDENSEKDFLKITVSVPRMVSNLRTFIESGIYLKV
YDQDRNEVRVAFSRQTYEANLPYTLRFLLDCNIVSGSWLKIPKGQYTLVEQPSCYKVHPS
KNGWDRSSTCSIEVVAEYDAVISLPLEGEYEEIGPIKILSFDIECIKLTGTGFPNANYDP
VIQISSVIYTHGKDINETRNFVFTLKDCDQLSNAAVLSFETEDQLLLAWSDFLVQVDPDF
LTGYNIIVFDLPYLLTRSTVLNIERFKKITRIRSTSSNFKDAIVSNNMMGTYENKDINIE
GRIMFDVYDLVRRDHKLKSYTLNYVSFEFLGQQKEDVHYSTISKLQQGTSSDRRRIASYC
LKDAILPLLLINKLLLVFNYVEMARVTSTPIKFLITRGQQIRVTMQIYRQCRKMKYVIPV
ISSAGRHGSNENNYEGATVLDPQKGYHTNPIAVLDFQSLYPSIMIAYNLCYSTLVPQNKI
LNHPEEDVTRIPGYIDLCFVKATKRKGILPIIVENLIEARRKAKKMMASCQDPMLKKVYD
GRQLALKVTTNSVYGYTGAASGGFLPCVDVATAITSFGRNIILNTKNIIEDHFTVKNGYK
NDAKVVYGDTDSVMINFGTEDIQEAIDLGNEAASKITSVSVKPITLLFEKVYRPLLLLNK
KRYAGLYYNNSKTYEKIDCKGIETVRRDFCMLVQQMMERVLYLLLVELNLPAAIEFVKNK
VSELLRNEIDISLLVVTKSLGKLEYEQRLPHVELAKKLRKRDPGKAPGVGDRISYIIVKG
TKGEAQYDRAEEPLYVTENNLPIDTNHYLESIKTTLLRIFDVVMPNPQSLFSGEHTRVIN
ISSNTGGLMNKFLKKVNRCLSCNTVIQTSTFCDNCNQSKKQQVLLDKLKICRMKEETYFK
LWTHCQRCQGNLHSAVVCDNRDCPIFYRRVKTSKDLSNLVNTLNTLQIGYED
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattgaaccggagaatacatcatttggacagtattctaacttctacgggacc
aaaaatgactatggaacgctattcagatcactgaaaaggcccgatgtagactacatattt
ttccttacggacgctgattacacattcaaaaatgtgaaatatgacgcgaacggtggatcg
gaaaggtcggatcagggcactgaggttccgataataaggctgtacggagtaacaaagcag
gagcagagtgttctggtctcattgcaaaactttaacccgtacttttacatagagaagcca
gcagcgctgctggacaggcactttgatgacctgaaggaactgtttacaagacatttgagc
gaacaaaatcaatttaagagaagtttgcgatacgtgttggatatccagaaggttaggttg
acgtcgctaatgctgtacgatgagaattctgaaaaggattttttgaagataacagtgtca
gtgccacgaatggtgtcgaacctgagaacgttcatagagtcgggaatatacctgaaggtg
tacgaccaggacagaaacgaagtgcgagtggcgttttcaagacaaacgtacgaagcaaac
ctgccgtacacactgcgcttcctgctggactgcaacatcgtgagcggctcatggctgaag
ataccaaaggggcagtacacactggtggaacagccgagctgctacaaagtccacccgagc
aagaacgggtgggataggagtagcacctgctcaatagaagtggtggcagagtacgatgca
gtgatatcgctgccgctggaaggagagtacgaagagataggtccaataaagatactctcg
ttcgatatagagtgcatcaagttgaccggaacaggctttccaaatgcgaactatgaccca
gtgatacaaatatcctcggtaatatacacccatgggaaggacatcaacgagactaggaac
tttgtgtttacgctcaaggactgcgaccagctgtcgaacgcagcagtgctgtcatttgaa
acggaggaccagctgctgttggcatggtcagacttcctagtgcaagtggacccagatttc
ctaacaggatataacataattgtgttcgacttgccatacctgctgacgaggtcgacagtt
ctgaacatagagcgctttaagaagataacgagaataagaagcacaagttcaaactttaag
gacgcgatagtgtcgaataacatgatgggaacgtacgaaaacaaggatataaacatagag
gggaggatcatgtttgacgtgtacgacctggtgagaagagatcacaaactgaagtcgtac
acgctcaactacgtgtcattcgagttcctagggcagcaaaaggaggacgtgcactactcg
acaatatcgaagctacagcaaggaacgagtagcgacaggagaagaatagcaagctactgt
ttgaaggacgcaatactgccgctgctgctgataaataagctactgctggtgttcaactac
gtggagatggcgagagtgacgtcgacgcctatcaagtttctcataacaagaggacagcag
atcagagtgaccatgcagatatacaggcagtgtaggaagatgaagtacgttattccagtg
atcagcagcgcggggagacacgggagcaacgaaaacaactacgaaggagcgacggtgttg
gacccgcaaaagggatatcacacaaatccaatcgcagtgctggattttcagagtctgtac
ccgtcaataatgatagcatataacctgtgctactcgacgctggtgccgcaaaataaaata
ttaaatcacccagaagaagatgtaacgaggataccagggtacatcgacctgtgtttcgta
aaggcaacaaagaggaagggaatattgccaatcattgttgaaaatttaatcgaagcacgc
aggaaggccaagaagatgatggccagctgccaagatccgatgctgaaaaaggtgtacgac
ggaagacagctggcacttaaagtaacaacgaactcggtgtacggatacacaggagcagct
agcggaggatttctaccgtgtgtagatgttgcaacagcaattacatcctttggaagaaat
attattctaaacacaaaaaacataatcgaggatcactttacagtaaagaatggatataaa
aatgacgccaaagtggtgtacggcgacacggattcagtgatgatcaatttcggcacggaa
gatatccaggaggccatagatctcggaaatgaagcagcaagtaaaataacaagcgtgtca
gtgaagccaataacactgctttttgaaaaggtctacaggccactactgttattgaataag
aagagatatgcaggtttatactacaacaacagtaagacgtatgaaaagatagactgtaag
gggattgaaaccgttagaagagacttttgtatgttggtacagcagatgatggagcgagtg
ttgtacctattgctggtggagttgaacctcccagctgcaatcgagtttgtaaagaacaaa
gtgtctgagttgctgaggaatgaaatagacataagcctactggtggtgacaaaatcactg
ggaaaactggaatatgaacagaggctaccgcacgtggagttagcaaaaaaactaaggaag
agagaccctggtaaagcaccaggtgttggagatcgcataagctacataatagtaaaggga
accaaaggagaagctcaatacgacagagcagaggaaccactgtacgtgacggagaacaac
ctacccatcgatacaaatcactacctggagtcaataaagacaacactacttcgcatattc
gacgttgtaatgccgaatccacagtcactgttcagcggtgaacacacgagagtgattaac
ataagcagtaacactggtggactaatgaataagtttctgaagaaggtaaacagatgcctg
agctgcaacacagtgatacaaacaagcaccttttgcgacaactgcaatcaatcaaaaaaa
caacaggtgctactcgacaagctcaagatatgtcgcatgaaggaggaaacgtattttaag
ctatggacacactgtcaaagatgccagggtaacctacacagcgctgtcgtctgtgacaac
agagactgtccaatattctaccggcgagttaagacctccaaggacctatcgaacttggtg
aacacgctaaacacactgcaaataggctacgaggactaa

DBGET integrated database retrieval system