KEGG   Theileria orientalis: TOT_030000615Help
Entry
TOT_030000615     CDS       T03460                                 

Definition
(RefSeq) succinate dehydrogenase subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tot  Theileria orientalis
Pathway
tot00020  Citrate cycle (TCA cycle)
tot00190  Oxidative phosphorylation
tot01100  Metabolic pathways
tot01110  Biosynthesis of secondary metabolites
tot01130  Biosynthesis of antibiotics
tot01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TOT_030000615
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TOT_030000615
Enzymes [BR:tot01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TOT_030000615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 20715779
NCBI-ProteinID: XP_009691654
UniProt: J4C8T6
LinkDB All DBs
Position
3:join(1332339..1332402,1332560..1332733,1332833..1333192,1333203..1334651,1334797..1334909)
Genome map
AA seq 719 aa AA seqDB search
MFRFKNIFKCNPRHFSTATRSGFKVVTHDYDAIVIGAGGAGLRSALELSILGHKTACISK
LFPTRSHTVAAQGGINAALGNMGEDDWRWHFYDTVKGSDWLGDQDSIYHMCKSAPSAVIE
LENFGVPFSRNEEGKIYQRAFGGQSLNFGKGGQAYRCAAVADRTGHSLLHTMYSTCLKYN
CSFFIEYFLVDLIKHPHENLTVKNDAGIIGGIFARMSNMELHVFRANHVVIATGGFGRCY
FSCTSAHMCTGDGNAAVSRLGLPQQDMEFVQFHPTGIYPAGCLITEGCRGEGGILRNCEG
EAFMARYAPVAKDLASRDVVSRSMTVEINEGRGCGPDKDHLYLDLTHLSEDVFREKLPGI
TETSKIFAGVDARKEYIPVLPTVHYNMGGIPTNYKTQVLTSVQAAVSPQGAKPAKSGKGS
RTKTSEPTSATSGSVGASGPSGSSVSAVSLGNGGYFTTPRASTGPTSSELVDHVVYGLYS
AGESACASVHGANRLGANSLLDIIVFGKMSGTTINEQIKSDASNASNLPDSSLYKEAVDR
AVDKMATLLSGNSTSGSSATSMKVSELRLEMQKSMQKYVSVFRDGKSLLEGKNKLRELAN
QFQYVRISDGSKAFNTDLYEALELENLLQLSLQTVTAAEARRESRGAHSREDCPKRDDET
WRRHSLTYLNNASRSKNHTQGFGYDGTHGGYDVVVGYRNVIDETLGSDMKTIPPFERTY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatttaaaaatatttttaaatgtaatcctagacacttctcaacagcaaccaga
tcaggattcaaagtcgtaactcatgattacgacgcaattgtgattggagccgggggagcg
ggcttgagatcggccctggaactatcgattctagggcataaaacggcctgtatctcgaaa
ttgttcccaacgagatcacatacagtcgctgcacagggaggtatcaacgcagcactaggc
aacatgggcgaggacgactggaggtggcatttttacgacacagtcaagggctcggactgg
ctgggagaccaggatagcatataccacatgtgcaagagcgcgccgagtgcagtgattgag
ttggaaaacttcggagtgcccttctcgagaaacgaagaggggaagatctaccagagagcg
ttcggaggacagagcttgaatttcggaaagggaggccaggcgtacagatgcgcagcagtg
gcagacagaacaggacactcgctgctgcatacaatgtattcgacgtgtttaaagtacaac
tgttcgttcttcatagagtacttcctggtggacctgataaaacacccgcacgaaaatctc
accgttaagaacgatgcaggaataattggagggatcttcgcaagaatgagtaacatggag
ctgcacgtgttcagagcgaaccacgtggtcatcgccacgggaggcttcggaagatgctac
ttcagctgcacgtcggcacacatgtgcacgggagacggaaacgcagcagtgagtagactg
ggactgccgcagcaagacatggagttcgtgcagttccacccaacgggaatatacccagca
gggtgcctgataacggaggggtgcagaggagagggaggaatactgcgcaactgcgaagga
gaagcgttcatggcgagatacgcccctgtggcgaaggacctggcgtccagagacgtggtg
agcaggtcaatgacagtggagatcaacgaagggcgaggatgcgggccagacaaggaccac
ctctacctggacctgacgcacctgagcgaggacgtcttcagagagaagctgccaggaata
acggaaacgagtaaaatattcgcaggagtggacgcgaggaaggagtacatcccagtcttg
ccaacagtgcactacaacatgggaggaataccgacgaactataagacgcaggtgctgacg
agtgtacaggcagcagtgagtccacagggagcaaagccagcaaagagtggcaaggggtcg
agaacaaagaccagtgagccaacgagtgcaaccagtgggtcagtgggagccagtggaccc
agtggatccagtgttagtgcagtaagtctgggaaacggaggttactttacgacccccaga
gcaagcacagggcccacgagcagtgagctagtggaccacgtggtctacggactgtacagc
gcaggcgaaagcgcgtgcgccagcgtgcacggagcgaacagactgggagcaaactcgctc
ctggacatcatcgtcttcggcaaaatgtcaggaacgacaataaacgaacagataaaaagc
gacgcgagcaacgcaagtaacttgccggactcaagtctctacaaggaggccgtggacagg
gcagtggacaagatggcgacgctgctgtcggggaactcaacgagtggcagtagcgccacg
agcatgaaagtgagcgagctgaggctggagatgcagaagagcatgcagaagtacgtgagc
gtcttcagagacgggaagtcgctgctcgagggcaagaacaagctgagggagctcgcgaac
cagttccagtacgtgaggatcagcgacgggagcaaggccttcaacacggacctctacgag
gcgctggagctggaaaacctgctgcagctcagtctgcagacggtgacggccgcggaggct
aggagggagtcaaggggcgcgcattcgcgggaggactgcccgaagagggacgacgagact
tggaggaggcactcattgacgtacctcaacaacgcgagcagaagtaagaaccatacgcaa
ggctttggatatgatggaacacacggaggctacgacgtcgtcgtgggataccgcaacgta
attgacgagacgctcggcagtgacatgaagacgataccgccattcgaaagaacatactaa

DBGET integrated database retrieval system