KEGG   Tomitella sp. HY188: FO059_09210Help
Entry
FO059_09210       CDS       T06118                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
toy  Tomitella sp. HY188
Pathway
toy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
toy01100  Metabolic pathways
toy01110  Biosynthesis of secondary metabolites
toy01130  Biosynthesis of antibiotics
toy01230  Biosynthesis of amino acids
Module
toy_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:toy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FO059_09210
Enzymes [BR:toy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     FO059_09210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin AAA Cytidylate_kin2 AAA_5 Mg_chelatase AAA_28 Zeta_toxin AAA_17 AAA_22 AAA_24 RuvB_N MMR_HSR1 ABC_tran RNA_helicase
Motif
Other DBs
NCBI-ProteinID: QDQ97470
LinkDB All DBs
Position
complement(2025585..2026187)
Genome map
AA seq 200 aa AA seqDB search
MAPRAVMVGPPGAGKSTIGRRLASALGVGIVDTDSEVERREGRPIREIFAADGEAAFRRI
EEDVVRESLQRSDGVVSLGGGAVLSARTRALLRGHAVVFLDISAHEGLLRTGIAGRLRGH
PGKDDETRPLLQGDDPAGRYRELIRERRPLYEEVATLVVHTDRRSPGKVVREIAGLIEST
ETDAAGHAGGQHGTIGEQHH
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgcgcagtgatggtggggccgcccggcgccggaaaatccaccatcggtcgc
aggctcgcctccgcgctgggcgtgggcatcgtcgacacggactccgaggtggagcgccgc
gagggccgcccgatccgcgagatcttcgccgccgacggggaggcggcgttccgccgcatc
gaagaggacgtggtgcgcgaatcgctgcagcgctccgacggggtggtctcgctgggcggt
ggggcggtgctctccgcgcgcacccgtgcgctcctgcgcggccatgccgtggtgttcctg
gacatcagcgcccacgaggggctgctgcgcaccggaatagcgggccggctgcgcggacac
ccgggcaaggacgacgagaccaggccccttctgcagggcgacgaccccgcgggacggtac
cgcgaactcatccgcgagcggcgcccgctgtatgaagaggtggccacgctggtggtccac
actgacaggcgcagccccggcaaggtggtccgcgagatcgccgggctgatcgagtcgacg
gaaacagacgccgccggacacgccggcggtcagcacggcaccatcggtgaacagcaccac
tag

DBGET integrated database retrieval system