KEGG   Treponema pallidum subsp. pallidum Nichols: TP_0805Help
Entry
TP_0805           CDS       T00016                                 

Definition
(GenBank) exoribonuclease II (rnb)
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
tpa  Treponema pallidum subsp. pallidum Nichols
Brite
KEGG Orthology (KO) [BR:tpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tpa03016]
    TP_0805
Enzymes [BR:tpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     TP_0805
Transfer RNA biogenesis [BR:tpa03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    TP_0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1 DTW
Motif
Other DBs
NCBI-ProteinID: AAC65772
UniProt: O83783
LinkDB All DBs
Position
complement(873482..875761)
Genome map
AA seq 759 aa AA seqDB search
MMELHVGSPVLYRKRPACVHAIERGKDAKITIETEHGLRRVRVKDVLLLHPGTVSSLVEL
LSASHIARISEESVQDAREFFGTEAPSFFELAELLWGASAAQSWAYWEQSVQSAYFVCNE
PAAAVRIRSQQECASCAVQEEKKEARQALKQAFIQELRRVARSARNMAPTAQEGMHRVHV
SQVNEQFTPFLQEIEAFALGHANRCKILQCALGCEHREQAHEILLHFGFWPVYRNPYPDR
LCPLFLSPAHVSGSDGERAAQQDVHTHRCVTQARTDCTHLAAYAIDGEGTRDPDDAISFD
GTYFWIHVASPAELVLPDSHADACARTRGRSLYLPEGAVRMLSDVVVDTCALARDAVSPA
LSFKILLDEHGDISCVHVLRSMVRVTRLSYAEADSQRDTPALQPLFDFARNNIARRKGRG
AVDICFPDVHMRVDFPVQETGQAGKEMNAGDVPDTQGKVPRVHIEAQQSYESMSMVREFM
LLAGEAAARFAFLHNLAFPYVSQERPQLPVQLPAGLAGEYKKRRAMKARRVSTTAAVHAA
LGLSQYSQVTSPLRRYVDLLAHQQLLACIDHAYAKAPAVGSAQTNETLALKLAQADEAAR
QATQAERVSRRHWTLVYFLMHPHTRYEAIVLEPLQPRAHVWLPAVALEADVALGRQAQFN
ERVMLRVVRVRLATLEVHFSVCEHCHRGVTQAVEGEAEQPSXEEYVFGSVLFPCGYFRRC
VYXSHLAGSSLQGVPGFCVKVQCFGQIECKGXQSSLVCG
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
gtgatggaactacatgtggggagtccggtgctctatcgaaagcgccctgcgtgtgtacac
gctatcgagcgagggaaggatgcgaagatcaccattgaaaccgaacacgggttaagacgc
gtgcgcgtgaaagacgttttgctcttgcacccgggcactgtttcttccctggtagaacta
ttgtctgcgtctcacattgcgcgtataagcgaggaatccgtacaggacgcgcgcgagttt
ttcggtaccgaagctccttccttttttgaacttgcagagctcctctggggggcttctgcc
gcgcagtcgtgggcctattgggagcaaagtgtgcaaagtgcgtattttgtttgcaatgag
cctgccgccgcagtgcgcatccgctctcagcaagagtgcgcatcctgcgcagtgcaggaa
gaaaaaaaggaagcgcgtcaggcgttaaagcaggcgttcatccaggagctacggcgcgtc
gcacgaagtgcacgcaatatggcaccaactgcgcaggaaggaatgcatcgtgtgcacgtg
tcgcaggtgaacgagcagtttacgccctttctgcaggaaatcgaagcgttcgcgttgggg
cacgcgaatcgctgtaagattttgcagtgtgccttaggctgcgagcacagggagcaagcg
catgaaatactcttgcacttcgggttctggccggtgtatcgcaatccgtatcctgatcgt
ctgtgtcctctatttttaagtcctgctcatgtgtctggttctgatggagaacgtgcggcg
cagcaagatgtgcacacacataggtgtgtcactcaagcacgcacagattgtacgcatctt
gccgcgtatgccatcgatggggagggtacgcgcgaccctgacgatgcgatcagtttcgat
ggtacgtatttttggatccatgtagcgagccctgcagagctcgttcttcctgattcgcac
gcagatgcatgcgcacgtacacggggtcgttcgctctatttgcctgaaggcgcagtgcgc
atgctcagcgacgtggtggttgatacgtgtgcactcgcgcgcgacgcagtttctcctgca
ctgtcttttaaaattttacttgatgagcacggtgacatcagctgtgtgcacgtgctccgg
agcatggtgcgtgttacgcgcctttcctatgcggaggcggattcccagcgcgataccccc
gcgttgcagcctctttttgactttgcgcgcaacaacattgcacggagaaaagggcgcggc
gcagtggacatttgctttcctgatgtccacatgagggtagattttcctgtgcaagaaaca
gggcaagcgggaaaggaaatgaacgccggggacgtgcccgatacacagggaaaggtgccg
cgtgttcacattgaagcacagcagtcgtacgagtctatgagcatggtgcgtgaattcatg
ctcttagcgggagaagcggcagcacggtttgcctttctacataaccttgcctttccttat
gtgagtcaggaacgtcctcagctgcccgtgcaactaccagcgggattggcgggggagtac
aaaaagcggcgcgcgatgaaagctcgtcgcgtgagcacaaccgccgcggtgcacgcagca
ctcgggctgtctcagtacagtcaggtgaccagtcctttgcgtcgctatgtggatttgctt
gcgcatcaacaattactggcgtgtattgatcacgcgtatgcaaaagctcctgctgtagga
agtgcacagacaaacgagacgcttgcgctcaagcttgcgcaggcagatgaggcagcgcgc
caggccacacaagcagagcgtgtatcgcgtcgtcactggacgctcgtatactttttgatg
cacccacacacgcggtacgaagcgattgtgttggagccactgcaaccgcgtgcrcacgtg
tggttacctgctgttgctcttgaggcggatgtagcattaggtcggcaggcgcagttcaac
gaacgcgtaatgctccgtgtcgtgcgtgtgcgccttgccacgttagaagtacatttttct
gtctgcgagcactgtcaccgcggcgtgacgcaggctgtagaaggtgaggcggagcagccc
tcakaagaggagtatgttttcggatctgtgttattcccctgtggatatttcaggcggtgc
gtgtacrgtagccacttggctggttcctccctgcagggcgtgcccggtttctgcgtcaaa
gtacagtgctttggacaaatcgagtgcaagggtwagcaaagttccctcgtgtgcggttag

DBGET integrated database retrieval system